Gene Gene information from NCBI Gene database.
Entrez ID 11171
Gene name Serine/threonine kinase receptor associated protein
Gene symbol STRAP
Synonyms (NCBI Gene)
MAWDPT-WDUNRIP
Chromosome 12
Chromosome location 12p12.3
miRNA miRNA information provided by mirtarbase database.
242
miRTarBase ID miRNA Experiments Reference
MIRT025462 hsa-miR-34a-5p Proteomics 21566225
MIRT025462 hsa-miR-34a-5p Proteomics 21566225
MIRT025462 hsa-miR-34a-5p Proteomics 21566225
MIRT031678 hsa-miR-16-5p Proteomics 18668040
MIRT036801 hsa-miR-374b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IEA
GO:0000387 Process Spliceosomal snRNP assembly EXP 12067652
GO:0000387 Process Spliceosomal snRNP assembly IBA
GO:0000387 Process Spliceosomal snRNP assembly IDA 18984161
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605986 30796 ENSG00000023734
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3F4
Protein name Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD)
Protein function The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 49 87 WD domain, G-beta repeat Repeat
PF00400 WD40 91 128 WD domain, G-beta repeat Repeat
PF00400 WD40 134 170 WD domain, G-beta repeat Repeat
PF00400 WD40 255 293 WD domain, G-beta repeat Repeat
Sequence
MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKG
AVWGATLNKDATKAATAAADFTAKVWD
AVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQ
DKLLRIYD
LNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSL
NFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVA
GGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTY
GLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Downregulation of TGF-beta receptor signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLORECTAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinoma Hepatocellular Associate 36581319
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Associate 21502811, 36551208
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 15720808
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Death Associate 15720808
★☆☆☆☆
Found in Text Mining only
Hypertension Associate 32664164
★☆☆☆☆
Found in Text Mining only
Myelodysplastic Syndromes Associate 28436936
★☆☆☆☆
Found in Text Mining only
Necrosis Associate 29046333
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 15720808, 17309779, 35272839
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Associate 35272839
★☆☆☆☆
Found in Text Mining only
Smoke Inhalation Injury Associate 32564237
★☆☆☆☆
Found in Text Mining only