Gene Gene information from NCBI Gene database.
Entrez ID 11168
Gene name PC4 and SRSF1 interacting protein 1
Gene symbol PSIP1
Synonyms (NCBI Gene)
DFS70LEDGFPAIPPSIP2p52p75
Chromosome 9
Chromosome location 9p22.3
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT016293 hsa-miR-193b-3p Microarray 20304954
MIRT019773 hsa-miR-375 Microarray 20215506
MIRT020538 hsa-miR-155-5p Proteomics 18668040
MIRT023558 hsa-miR-1-3p Proteomics 18668040
MIRT023558 hsa-miR-1-3p Proteomics;Microarray 18668037
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
HDAC1 Unknown 23386123
SP1 Unknown 22019592;23386123
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000395 Process MRNA 5'-splice site recognition IDA 9885563
GO:0000791 Component Euchromatin ISS
GO:0000792 Component Heterochromatin IDA 12796494
GO:0003677 Function DNA binding IEA
GO:0003682 Function Chromatin binding IDA 20974633
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603620 9527 ENSG00000164985
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75475
Protein name PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52)
Protein function Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell
PDB 1Z9E , 2B4J , 2M16 , 2MSR , 2MTN , 2N3A , 3F9K , 3HPG , 3HPH , 3U88 , 3ZEH , 4FU6 , 5N88 , 5OYM , 5YI9 , 6EMO , 6EMP , 6EMQ , 6EMR , 6S01 , 6TRJ , 6TVM , 6ZV0 , 7OUF , 7OUG , 7OUH , 7PEL , 7Z1Z , 8CBN , 8CBQ , 8PC5 , 8PC6 , 8PEO , 8PEP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00855 PWWP 5 89 PWWP domain Domain
PF11467 LEDGF 349 450 Lens epithelium-derived growth factor (LEDGF) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventr
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPK
VKFSSQQAATKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQH
EEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN
Sequence length 530
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Viral life cycle - HIV-1   Integration of provirus
2-LTR circle formation
Integration of viral DNA into host genomic DNA
Autointegration results in viral DNA circles
APOBEC3G mediated resistance to HIV-1 infection
Vpr-mediated nuclear import of PICs
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Adrenocortical carcinoma, hereditary Benign rs35678110 RCV005904806
Cervical cancer Benign rs35678110 RCV005904807
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 33133072
Agnosia Associate 24604027
Anemia Refractory Associate 19692701
Arthritis Associate 19490633
Arthritis Juvenile Associate 33133072
Arthritis Psoriatic Associate 20631726
Autoimmune Diseases Associate 20484370, 22275515, 26771192
Autoimmune Diseases Stimulate 37047137
Breast Neoplasms Associate 28633434
Carcinogenesis Stimulate 24604027