Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11142
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP-dependent protein kinase inhibitor gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PKIG
Synonyms (NCBI Gene) Gene synonyms aliases	PKI-gamma
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the protein kinase inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive cAMP-dependent protein kinase inhibitor, and is a predominant form of inhibitor in various tissu

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043316	hsa-miR-331-3p	CLASH	23622248
MIRT038181	hsa-miR-331-5p	CLASH	23622248
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237542	hsa-miR-1825	CLIP-seq
MIRT1237543	hsa-miR-3192	CLIP-seq
MIRT1237544	hsa-miR-326	CLIP-seq
MIRT1237545	hsa-miR-330-5p	CLIP-seq
MIRT1237546	hsa-miR-3679-3p	CLIP-seq
MIRT1237547	hsa-miR-4314	CLIP-seq
MIRT1237548	hsa-miR-4646-5p	CLIP-seq
MIRT1237549	hsa-miR-4755-3p	CLIP-seq
MIRT1237550	hsa-miR-1587	CLIP-seq
MIRT1237551	hsa-miR-185	CLIP-seq
MIRT1237552	hsa-miR-1912	CLIP-seq
MIRT1237553	hsa-miR-2052	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237554	hsa-miR-3135b	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237555	hsa-miR-323-5p	CLIP-seq
MIRT1237556	hsa-miR-3652	CLIP-seq
MIRT1237557	hsa-miR-3689d	CLIP-seq
MIRT1237558	hsa-miR-378	CLIP-seq
MIRT1237559	hsa-miR-378b	CLIP-seq
MIRT1237560	hsa-miR-378c	CLIP-seq
MIRT1237561	hsa-miR-378d	CLIP-seq
MIRT1237562	hsa-miR-378e	CLIP-seq
MIRT1237563	hsa-miR-378f	CLIP-seq
MIRT1237564	hsa-miR-378h	CLIP-seq
MIRT1237565	hsa-miR-378i	CLIP-seq
MIRT1237566	hsa-miR-422a	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237567	hsa-miR-4306	CLIP-seq
MIRT1237568	hsa-miR-4430	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237569	hsa-miR-4475	CLIP-seq
MIRT1237570	hsa-miR-4492	CLIP-seq
MIRT1237571	hsa-miR-4498	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237572	hsa-miR-4638-3p	CLIP-seq
MIRT1237573	hsa-miR-4644	CLIP-seq
MIRT1237574	hsa-miR-4656	CLIP-seq
MIRT1237575	hsa-miR-4668-3p	CLIP-seq
MIRT1237576	hsa-miR-4674	CLIP-seq
MIRT1237577	hsa-miR-4675	CLIP-seq
MIRT1237578	hsa-miR-4694-5p	CLIP-seq
MIRT1237579	hsa-miR-4699-5p	CLIP-seq
MIRT1237580	hsa-miR-4741	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq
MIRT1237582	hsa-miR-711	CLIP-seq
MIRT1237583	hsa-miR-762	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT2069867	hsa-miR-597	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq
MIRT2297208	hsa-miR-1253	CLIP-seq
MIRT1237542	hsa-miR-1825	CLIP-seq
MIRT2297209	hsa-miR-3919	CLIP-seq
MIRT2297210	hsa-miR-4640-5p	CLIP-seq
MIRT2297211	hsa-miR-4726-5p	CLIP-seq
MIRT2297212	hsa-miR-4731-5p	CLIP-seq
MIRT2297213	hsa-miR-485-5p	CLIP-seq
MIRT2297214	hsa-miR-488	CLIP-seq
MIRT2432139	hsa-miR-135a	CLIP-seq
MIRT2432140	hsa-miR-135b	CLIP-seq
MIRT2432141	hsa-miR-3662	CLIP-seq
MIRT2432142	hsa-miR-4645-3p	CLIP-seq
MIRT2594554	hsa-miR-188-5p	CLIP-seq
MIRT1237553	hsa-miR-2052	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237555	hsa-miR-323-5p	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237575	hsa-miR-4668-3p	CLIP-seq
MIRT2594555	hsa-miR-4694-3p	CLIP-seq
MIRT2594556	hsa-miR-548c-3p	CLIP-seq
MIRT2594557	hsa-miR-605	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007165	Process	Signal transduction	IEA
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:2000480	Process	Negative regulation of cAMP-dependent protein kinase activity	IBA	21873635

MIM	HGNC	e!Ensembl
604932	9019	ENSG00000168734

Protein

UniProt ID

Q9Y2B9

Protein name

cAMP-dependent protein kinase inhibitor gamma (PKI-gamma)

Protein function

Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02827	PKI	2 → 70	cAMP-dependent protein kinase inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPD
KEAGNQPQSSDGTTSS

Sequence length

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Severe combined immunodeficiency disease	Severe Combined Immunodeficiency, Severe combined immunodeficiency due to adenosine deaminase deficiency, SCID Due to ADA Deficiency, Early-Onset	rs886037607, rs118203993, rs121908714, rs121908739, rs121908740, rs121908735, rs121908721, rs121908722, rs121908156, rs1564414523, rs1564418254, rs1564446526, rs786205074, rs121908157, rs121908159 View all (197 more)	19179314, 26255240, 9758612, 1284479, 17185467, 9414266, 3475710, 23260757, 26376800, 16276484, 1346349, 1680289, 21624848, 20544538, 8401541 View all (16 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	26974007	ClinVar
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining
Thrombocytosis	Associate	29420626

PKIG (cAMP-dependent protein kinase inhibitor gamma)