Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	11142
Gene name	CAMP-dependent protein kinase inhibitor gamma
Gene symbol	PKIG
Synonyms (NCBI Gene)	PKI-gamma
Chromosome	20
Chromosome location	20q13.12
Summary	This gene encodes a member of the protein kinase inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive cAMP-dependent protein kinase inhibitor, and is a predominant form of inhibitor in various tissu

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043316	hsa-miR-331-3p	CLASH	23622248
MIRT038181	hsa-miR-331-5p	CLASH	23622248
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237542	hsa-miR-1825	CLIP-seq
MIRT1237543	hsa-miR-3192	CLIP-seq
MIRT1237544	hsa-miR-326	CLIP-seq
MIRT1237545	hsa-miR-330-5p	CLIP-seq
MIRT1237546	hsa-miR-3679-3p	CLIP-seq
MIRT1237547	hsa-miR-4314	CLIP-seq
MIRT1237548	hsa-miR-4646-5p	CLIP-seq
MIRT1237549	hsa-miR-4755-3p	CLIP-seq
MIRT1237550	hsa-miR-1587	CLIP-seq
MIRT1237551	hsa-miR-185	CLIP-seq
MIRT1237552	hsa-miR-1912	CLIP-seq
MIRT1237553	hsa-miR-2052	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237554	hsa-miR-3135b	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237555	hsa-miR-323-5p	CLIP-seq
MIRT1237556	hsa-miR-3652	CLIP-seq
MIRT1237557	hsa-miR-3689d	CLIP-seq
MIRT1237558	hsa-miR-378	CLIP-seq
MIRT1237559	hsa-miR-378b	CLIP-seq
MIRT1237560	hsa-miR-378c	CLIP-seq
MIRT1237561	hsa-miR-378d	CLIP-seq
MIRT1237562	hsa-miR-378e	CLIP-seq
MIRT1237563	hsa-miR-378f	CLIP-seq
MIRT1237564	hsa-miR-378h	CLIP-seq
MIRT1237565	hsa-miR-378i	CLIP-seq
MIRT1237566	hsa-miR-422a	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237567	hsa-miR-4306	CLIP-seq
MIRT1237568	hsa-miR-4430	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237569	hsa-miR-4475	CLIP-seq
MIRT1237570	hsa-miR-4492	CLIP-seq
MIRT1237571	hsa-miR-4498	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237572	hsa-miR-4638-3p	CLIP-seq
MIRT1237573	hsa-miR-4644	CLIP-seq
MIRT1237574	hsa-miR-4656	CLIP-seq
MIRT1237575	hsa-miR-4668-3p	CLIP-seq
MIRT1237576	hsa-miR-4674	CLIP-seq
MIRT1237577	hsa-miR-4675	CLIP-seq
MIRT1237578	hsa-miR-4694-5p	CLIP-seq
MIRT1237579	hsa-miR-4699-5p	CLIP-seq
MIRT1237580	hsa-miR-4741	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq
MIRT1237582	hsa-miR-711	CLIP-seq
MIRT1237583	hsa-miR-762	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT2069867	hsa-miR-597	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq
MIRT2297208	hsa-miR-1253	CLIP-seq
MIRT1237542	hsa-miR-1825	CLIP-seq
MIRT2297209	hsa-miR-3919	CLIP-seq
MIRT2297210	hsa-miR-4640-5p	CLIP-seq
MIRT2297211	hsa-miR-4726-5p	CLIP-seq
MIRT2297212	hsa-miR-4731-5p	CLIP-seq
MIRT2297213	hsa-miR-485-5p	CLIP-seq
MIRT2297214	hsa-miR-488	CLIP-seq
MIRT2432139	hsa-miR-135a	CLIP-seq
MIRT2432140	hsa-miR-135b	CLIP-seq
MIRT2432141	hsa-miR-3662	CLIP-seq
MIRT2432142	hsa-miR-4645-3p	CLIP-seq
MIRT2594554	hsa-miR-188-5p	CLIP-seq
MIRT1237553	hsa-miR-2052	CLIP-seq
MIRT1237535	hsa-miR-2467-3p	CLIP-seq
MIRT1237536	hsa-miR-3138	CLIP-seq
MIRT1237537	hsa-miR-3165	CLIP-seq
MIRT1237555	hsa-miR-323-5p	CLIP-seq
MIRT1237538	hsa-miR-4257	CLIP-seq
MIRT1237539	hsa-miR-4436b-3p	CLIP-seq
MIRT1237540	hsa-miR-4456	CLIP-seq
MIRT1237541	hsa-miR-4520a-3p	CLIP-seq
MIRT1237575	hsa-miR-4668-3p	CLIP-seq
MIRT2594555	hsa-miR-4694-3p	CLIP-seq
MIRT2594556	hsa-miR-548c-3p	CLIP-seq
MIRT2594557	hsa-miR-605	CLIP-seq
MIRT1237581	hsa-miR-668	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IBA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	TAS	9218452
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA

MIM	HGNC	e!Ensembl
604932	9019	ENSG00000168734

Q9Y2B9

Protein name

cAMP-dependent protein kinase inhibitor gamma (PKI-gamma)

Protein function

Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02827	PKI	2 → 70	cAMP-dependent protein kinase inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPD
KEAGNQPQSSDGTTSS

Sequence length

Interactions

View interactions

PKIG (cAMP-dependent protein kinase inhibitor gamma)