CHGA (chromogranin A)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1113
Gene name Gene Name - the full gene name approved by the HGNC.
Chromogranin A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHGA
Synonyms (NCBI Gene) Gene synonyms aliases
CGA, PHE5, PHES
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active pep
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT732556 hsa-miR-375 RNA-seq 33037409
MIRT889845 hsa-miR-4773 CLIP-seq
MIRT2200023 hsa-miR-197 CLIP-seq
MIRT2200024 hsa-miR-3974 CLIP-seq
MIRT2200025 hsa-miR-4670-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
Transcription factor Regulation Reference
CTNNB1 Unknown 21551321
EGR1 Activation 12456801
LEF1 Unknown 21551321
REST Unknown 19118055
SP1 Unknown 1819225
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(35)
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0002551 Process Mast cell chemotaxis IDA 21214543
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0005615 Component Extracellular space ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
118910 1929 ENSG00000100604
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P10645
Protein name Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into: Vasostatin-1 (Vasostatin I); Vasostatin-2 (Vasostatin II); EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin (SL21); AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RR
Protein function [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic an
PDB 1LV4 , 6R2X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01271 Granin 25 → 93 Granin (chromogranin or secretogranin) Family
PF01271 Granin 85 → 457 Granin (chromogranin or secretogranin) Family
Tissue specificity TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [GE-25]: Found in the brain.
Sequence 
MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Sequence length 457
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Antimicrobial peptides
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 21595568
Pheochromocytoma Pheochromocytoma rs121908826, rs121908830, rs121908821, rs5030821, rs5030820, rs104893826, rs5030808, rs587776644, rs80338844, rs104894306, rs104894309, rs75076352, rs75996173, rs77709286, rs74799832
View all (30 more)		 11116123
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 16504480
Show/Hide Text Mining Associations (118)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 16394290, 1954180, 32649013
Adenoma Oxyphilic Associate 1653518
Adrenocortical Adenoma Associate 40490431
Alzheimer Disease Associate 22046305, 24902845, 26284520, 32614981, 36912488
Alzheimer Disease Inhibit 32366888
Appendiceal Neoplasms Stimulate 16432362
Arrest of spermatogenesis Associate 21601192
Arthritis Juvenile Stimulate 39337398
Arthritis Rheumatoid Associate 39337398
Atherosclerosis Associate 26211667