CHGA (chromogranin A)

Gene

• Entrez ID: 1113
• Gene name: Chromogranin A
• Gene symbol: CHGA
• Synonyms (NCBI Gene): CGA, PHE5, PHES
• Chromosome: 14
• Chromosome location: 14q32.12
• Summary: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active pep

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT732556	hsa-miR-375	RNA-seq	33037409
MIRT889845	hsa-miR-4773	CLIP-seq
MIRT2200023	hsa-miR-197	CLIP-seq
MIRT2200024	hsa-miR-3974	CLIP-seq
MIRT2200025	hsa-miR-4670-3p	CLIP-seq
MIRT2200026	hsa-miR-5096	CLIP-seq
MIRT2442077	hsa-miR-3918	CLIP-seq
MIRT2442078	hsa-miR-4685-5p	CLIP-seq
MIRT2442079	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTNNB1	Unknown	21551321
EGR1	Activation	12456801
LEF1	Unknown	21551321
REST	Unknown	19118055
SP1	Unknown	1819225

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	ISS
GO:0002551	Process	Mast cell chemotaxis	IDA	21214543
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0008217	Process	Regulation of blood pressure	TAS	8406464
GO:0030133	Component	Transport vesicle	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0033366	Process	Protein localization to secretory granule	IEA
GO:0033604	Process	Negative regulation of catecholamine secretion	IBA
GO:0033604	Process	Negative regulation of catecholamine secretion	IDA	15326220
GO:0042583	Component	Chromaffin granule	IBA
GO:0042583	Component	Chromaffin granule	ISS
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043303	Process	Mast cell degranulation	IDA	21214543
GO:0045087	Process	Innate immune response	NAS	15723172
GO:0045576	Process	Mast cell activation	IDA	21214543
GO:0046676	Process	Negative regulation of insulin secretion	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20862257
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15723172
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	15723172
GO:0050832	Process	Defense response to fungus	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	TAS	22459152
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0098992	Component	Neuronal dense core vesicle	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1901899	Process	Positive regulation of relaxation of cardiac muscle	ISS
GO:2000707	Process	Positive regulation of dense core granule biogenesis	IEA
GO:2000707	Process	Positive regulation of dense core granule biogenesis	ISS

Other IDs

• MIM: 118910
• HGNC: 1929
• e!Ensembl: ENSG00000100604

Protein

• UniProt ID: P10645
• Protein name: Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into: Vasostatin-1 (Vasostatin I); Vasostatin-2 (Vasostatin II); EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin (SL21); AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RR
• Protein function: [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic an
• PDB: 1LV4, 6R2X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01271	Granin	25 → 93	Granin (chromogranin or secretogranin)	Family
  PF01271	Granin	85 → 457	Granin (chromogranin or secretogranin)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [GE-25]: Found in the brain.
• Sequence:

  MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
  RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
  VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
  TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
  EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
  QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
  QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
  EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

• Sequence length: 457

Pathways

Reactome:

Antimicrobial peptides