Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1113
Gene name Gene Name - the full gene name approved by the HGNC.	Chromogranin A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHGA
Synonyms (NCBI Gene) Gene synonyms aliases	CGA, PHE5, PHES
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active pep

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732556	hsa-miR-375	RNA-seq	33037409
MIRT889845	hsa-miR-4773	CLIP-seq
MIRT2200023	hsa-miR-197	CLIP-seq
MIRT2200024	hsa-miR-3974	CLIP-seq
MIRT2200025	hsa-miR-4670-3p	CLIP-seq
MIRT2200026	hsa-miR-5096	CLIP-seq
MIRT2442077	hsa-miR-3918	CLIP-seq
MIRT2442078	hsa-miR-4685-5p	CLIP-seq
MIRT2442079	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CTNNB1	Unknown	21551321
EGR1	Activation	12456801
LEF1	Unknown	21551321
REST	Unknown	19118055
SP1	Unknown	1819225

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	ISS
GO:0002551	Process	Mast cell chemotaxis	IDA	21214543
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0008217	Process	Regulation of blood pressure	TAS	8406464
GO:0030133	Component	Transport vesicle	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0033366	Process	Protein localization to secretory granule	IEA
GO:0033604	Process	Negative regulation of catecholamine secretion	IBA
GO:0033604	Process	Negative regulation of catecholamine secretion	IDA	15326220
GO:0042583	Component	Chromaffin granule	IBA
GO:0042583	Component	Chromaffin granule	ISS
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043303	Process	Mast cell degranulation	IDA	21214543
GO:0045087	Process	Innate immune response	NAS	15723172
GO:0045576	Process	Mast cell activation	IDA	21214543
GO:0046676	Process	Negative regulation of insulin secretion	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20862257
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15723172
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	15723172
GO:0050832	Process	Defense response to fungus	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	TAS	22459152
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0098992	Component	Neuronal dense core vesicle	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1901899	Process	Positive regulation of relaxation of cardiac muscle	ISS
GO:2000707	Process	Positive regulation of dense core granule biogenesis	IEA
GO:2000707	Process	Positive regulation of dense core granule biogenesis	ISS

MIM	HGNC	e!Ensembl
118910	1929	ENSG00000100604

Protein

UniProt ID

P10645

Protein name

Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into: Vasostatin-1 (Vasostatin I); Vasostatin-2 (Vasostatin II); EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin (SL21); AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RR

Protein function

[Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic an

PDB

1LV4 , 6R2X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01271	Granin	25 → 93	Granin (chromogranin or secretogranin)	Family
PF01271	Granin	85 → 457	Granin (chromogranin or secretogranin)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [GE-25]: Found in the brain.

Sequence

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Sequence length

457

Interactions

View interactions

	Reactome
			Antimicrobial peptides

CHGA (chromogranin A)