Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11124
Gene name Gene Name - the full gene name approved by the HGNC.	Fas associated factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FAF1
Synonyms (NCBI Gene) Gene synonyms aliases	CGI-03, HFAF1s, UBXD12, UBXN3A, hFAF1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p32.3
Summary Summary of gene provided in NCBI Entrez Gene.	Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis in

Show/Hide all(76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003319	hsa-miR-146a-5p	GFP reporter assay, qRT-PCR	20459811
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT006507	hsa-miR-24-3p	Luciferase reporter assay, Western blot	20195546
MIRT029548	hsa-miR-26b-5p	Microarray	19088304
MIRT049059	hsa-miR-92a-3p	CLASH	23622248
MIRT041754	hsa-miR-484	CLASH	23622248
MIRT041238	hsa-miR-193b-3p	CLASH	23622248
MIRT975113	hsa-miR-1293	CLIP-seq
MIRT975114	hsa-miR-139-3p	CLIP-seq
MIRT975115	hsa-miR-1827	CLIP-seq
MIRT975116	hsa-miR-298	CLIP-seq
MIRT975117	hsa-miR-338-3p	CLIP-seq
MIRT975118	hsa-miR-3940-5p	CLIP-seq
MIRT975119	hsa-miR-4483	CLIP-seq
MIRT975120	hsa-miR-4507	CLIP-seq
MIRT975121	hsa-miR-450b-5p	CLIP-seq
MIRT975122	hsa-miR-4530	CLIP-seq
MIRT975123	hsa-miR-4696	CLIP-seq
MIRT975124	hsa-miR-4795-3p	CLIP-seq
MIRT975125	hsa-miR-507	CLIP-seq
MIRT975126	hsa-miR-556-3p	CLIP-seq
MIRT975127	hsa-miR-557	CLIP-seq
MIRT975128	hsa-miR-562	CLIP-seq
MIRT1988910	hsa-miR-219-2-3p	CLIP-seq
MIRT1988911	hsa-miR-2964a-3p	CLIP-seq
MIRT1988912	hsa-miR-4452	CLIP-seq
MIRT975115	hsa-miR-1827	CLIP-seq
MIRT1988910	hsa-miR-219-2-3p	CLIP-seq
MIRT1988911	hsa-miR-2964a-3p	CLIP-seq
MIRT975116	hsa-miR-298	CLIP-seq
MIRT2223443	hsa-miR-3180-5p	CLIP-seq
MIRT975117	hsa-miR-338-3p	CLIP-seq
MIRT1988912	hsa-miR-4452	CLIP-seq
MIRT2223444	hsa-miR-4504	CLIP-seq
MIRT975121	hsa-miR-450b-5p	CLIP-seq
MIRT975122	hsa-miR-4530	CLIP-seq
MIRT975123	hsa-miR-4696	CLIP-seq
MIRT975125	hsa-miR-507	CLIP-seq
MIRT2223445	hsa-miR-542-3p	CLIP-seq
MIRT975126	hsa-miR-556-3p	CLIP-seq
MIRT975127	hsa-miR-557	CLIP-seq
MIRT2223446	hsa-miR-595	CLIP-seq
MIRT2527281	hsa-miR-1233	CLIP-seq
MIRT975113	hsa-miR-1293	CLIP-seq
MIRT2527282	hsa-miR-129-3p	CLIP-seq
MIRT975114	hsa-miR-139-3p	CLIP-seq
MIRT2527283	hsa-miR-151-5p	CLIP-seq
MIRT2527284	hsa-miR-151b	CLIP-seq
MIRT2527285	hsa-miR-1976	CLIP-seq
MIRT2527286	hsa-miR-3652	CLIP-seq
MIRT975118	hsa-miR-3940-5p	CLIP-seq
MIRT2527287	hsa-miR-4279	CLIP-seq
MIRT2527288	hsa-miR-4430	CLIP-seq
MIRT975119	hsa-miR-4483	CLIP-seq
MIRT2527289	hsa-miR-4505	CLIP-seq
MIRT975120	hsa-miR-4507	CLIP-seq
MIRT2527281	hsa-miR-1233	CLIP-seq
MIRT975113	hsa-miR-1293	CLIP-seq
MIRT2527282	hsa-miR-129-3p	CLIP-seq
MIRT975114	hsa-miR-139-3p	CLIP-seq
MIRT2527283	hsa-miR-151-5p	CLIP-seq
MIRT2527284	hsa-miR-151b	CLIP-seq
MIRT2527285	hsa-miR-1976	CLIP-seq
MIRT2527286	hsa-miR-3652	CLIP-seq
MIRT975118	hsa-miR-3940-5p	CLIP-seq
MIRT2527287	hsa-miR-4279	CLIP-seq
MIRT2527288	hsa-miR-4430	CLIP-seq
MIRT975119	hsa-miR-4483	CLIP-seq
MIRT2527289	hsa-miR-4505	CLIP-seq
MIRT975120	hsa-miR-4507	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Activation	17046979
RELA	Activation	17046979

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15688372, 15743842, 18775313, 21645854, 26842564, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15596450, 26842564
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005829	Component	Cytosol	IDA	15596450
GO:0006915	Process	Apoptotic process	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0019887	Function	Protein kinase regulator activity	NAS	11713579
GO:0019901	Function	Protein kinase binding	IDA	11713579
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0031072	Function	Heat shock protein binding	IDA	15596450
GO:0031265	Component	CD95 death-inducing signaling complex	NAS	12702723
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	18775313
GO:0034098	Component	VCP-NPL4-UFD1 AAA ATPase complex	IDA	18775313
GO:0036337	Process	Fas signaling pathway	IMP	15688372
GO:0036503	Process	ERAD pathway	IBA
GO:0042176	Process	Regulation of protein catabolic process	IMP	15743842
GO:0043065	Process	Positive regulation of apoptotic process	NAS	10462485
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	14600157
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043130	Function	Ubiquitin binding	IDA	18775313
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	15743842
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	26842564
GO:0045740	Process	Positive regulation of DNA replication	IMP	26842564
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11713579
GO:0051059	Function	NF-kappaB binding	IBA
GO:0051059	Function	NF-kappaB binding	IPI	14600157
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1990917	Component	Ooplasm	IEA

MIM	HGNC	e!Ensembl
604460	3578	ENSG00000185104

Protein

UniProt ID

Q9UNN5

Protein name

FAS-associated factor 1 (hFAF1) (UBX domain-containing protein 12) (UBX domain-containing protein 3A)

Protein function

Ubiquitin-binding protein (PubMed:19722279). Required for the progression of DNA replication forks by targeting DNA replication licensing factor CDT1 for degradation (PubMed:26842564). Potentiates but cannot initiate FAS-induced apoptosis (By si

PDB

1H8C , 2DZM , 2EC4 , 3E21 , 3QC8 , 3QCA , 3QQ8 , 3QWZ , 3QX1 , 3R3M , 7FGM , 7FGN , 8KG2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14555	UBA_4	8 → 43		Domain
PF00789	UBX	568 → 648	UBX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon. Not detected in the peripheral blood leukocytes. {ECO:0000269|PubMed:10462485}.

Sequence

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE

Sequence length

650

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Diabetes	Body mass index and type 2 diabetes (pairwise), Type 2 diabetes	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Renal Carcinoma	Renal cell carcinoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Stimulate	18573343
Alzheimer Disease	Associate	28539126
Atrial Fibrillation	Associate	29290336
Breast Neoplasms	Inhibit	22730322
Breast Neoplasms	Associate	24395524
Carcinoma Non Small Cell Lung	Associate	37999107
Colorectal Neoplasms	Associate	32179092
Diabetes Mellitus Type 2	Associate	25799151, 27115357, 27589775
Diabetes Mellitus Type 2	Stimulate	27589775
Esophageal Neoplasms	Stimulate	23921907
Glioma	Associate	30915356
Intervertebral Disc Degeneration	Associate	25280944, 35039758
Lung Neoplasms	Associate	37999107
Lymphoma Mantle Cell	Associate	18984860
Mitochondrial complex I deficiency	Associate	18573343
Neoplasm Metastasis	Inhibit	22730322
Neoplasms	Inhibit	22730322, 22876279, 24548782, 37999107
Neoplasms	Associate	22876279
Parkinson Disease	Stimulate	18573343
Stomach Neoplasms	Associate	23921907
Thyroid Cancer Papillary	Associate	21642358
Uterine Cervical Neoplasms	Associate	16004614
Uterine Cervical Neoplasms	Inhibit	22876279

FAF1 (Fas associated factor 1)