Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1112
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box N3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXN3
Synonyms (NCBI Gene) Gene synonyms aliases
C14orf116, CHES1, PRO1635
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q31.3-q32.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, r
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007196 hsa-miR-574-5p Luciferase reporter assay, qRT-PCR, Western blot 23133627
MIRT030800 hsa-miR-21-5p Microarray 18591254
MIRT040561 hsa-miR-92b-3p CLASH 23622248
MIRT054204 hsa-miR-210-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23028679
MIRT610933 hsa-miR-890 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602628 1928 ENSG00000053254
Protein
UniProt ID O00409
Protein name Forkhead box protein N3 (Checkpoint suppressor 1)
Protein function Acts as a transcriptional repressor. May be involved in DNA damage-inducible cell cycle arrests (checkpoints).
PDB 6NCE , 6NCM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 113 200 Forkhead domain Domain
Sequence
MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL
TNLNWLHESKNLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFS
CLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERS
QSIGKGSLWCIDPEYRQNLI
QALKKTPYHPHPHVFNTPPTCPQAYQSTSGPPIWPGSTFF
KRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGARVLSRGLFPGVRPLPITPIG
VTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSS
SADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKG
QKEQKETTKN
Sequence length 490
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Hypertension Idiopathic intracranial hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Breast Neoplasms Associate 28805661
Carcinoma Basal Cell Associate 32382535
Drug Related Side Effects and Adverse Reactions Stimulate 36768681
Hyperglycemia Associate 31543974
Hyperglycemic Hyperosmolar Nonketotic Coma Associate 31543974
Leukemia Monocytic Acute Inhibit 24727659
Leukemia Myeloid Associate 24727659
Nasopharyngeal Carcinoma Associate 33317407
Neoplasm Metastasis Associate 28805661