Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11101
Gene name Gene Name - the full gene name approved by the HGNC.	Arginyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATE1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018958	hsa-miR-335-5p	Microarray	18185580
MIRT020247	hsa-miR-130b-3p	Sequencing	20371350
MIRT051987	hsa-let-7b-5p	CLASH	23622248
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804136	hsa-miR-141	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804138	hsa-miR-186	CLIP-seq
MIRT804139	hsa-miR-194	CLIP-seq
MIRT804140	hsa-miR-200a	CLIP-seq
MIRT804141	hsa-miR-219-1-3p	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804146	hsa-miR-3065-3p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT804148	hsa-miR-3662	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804150	hsa-miR-4682	CLIP-seq
MIRT804151	hsa-miR-4691-5p	CLIP-seq
MIRT804152	hsa-miR-4698	CLIP-seq
MIRT804153	hsa-miR-4719	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804155	hsa-miR-571	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq
MIRT1937493	hsa-miR-2355-5p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT1937494	hsa-miR-3713	CLIP-seq
MIRT1937495	hsa-miR-3924	CLIP-seq
MIRT1937496	hsa-miR-4427	CLIP-seq
MIRT1937497	hsa-miR-4724-5p	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IBA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IDA	34893540
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IEA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	TAS	9858543
GO:0005515	Function	Protein binding	IPI	23455924, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	9858543
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9858543
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0010498	Process	Proteasomal protein catabolic process	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IMP	25970626
GO:0016598	Process	Protein arginylation	NAS	9858543
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	34893540
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	34893540
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	34893540
GO:0071596	Process	Ubiquitin-dependent protein catabolic process via the N-end rule pathway	IDA	34893540

MIM	HGNC	e!Ensembl
607103	782	ENSG00000107669

Protein

UniProt ID

O95260

Protein name

Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1)

Protein function

Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein (PubMed:34893540). This arginylation is required for degradation of the protein via the ubiquitin pathway (PubMed:34893540). Does no

PDB

8TZV , 8UAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04376	ATE_N	21 → 92	Arginine-tRNA-protein transferase, N terminus	Family
PF04377	ATE_C	290 → 429	Arginine-tRNA-protein transferase, C terminus	Family

Sequence

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGK
YVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
DDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSG
EPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPS
LFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQM
VIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILP
NCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIM
PYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

Sequence length

518

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast cancer	Breast cancer	N/A	N/A	GWAS
Breast Cancer	Postmenopausal breast cancer	N/A	N/A	GWAS
Congenital Heart Disease	congenital heart disease	N/A	N/A	GenCC
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	33687501
Amyotrophic Lateral Sclerosis	Associate	33687501
Breast Neoplasms	Associate	25381249, 31125336
Cholangiocarcinoma	Associate	36635225
COVID 19	Stimulate	36851505
Melanoma	Associate	35561126
Neoplasms	Inhibit	33330934
Neoplasms	Associate	35561126

ATE1 (arginyltransferase 1)