ATE1 (arginyltransferase 1)

Gene

• Entrez ID: 11101
• Gene name: Arginyltransferase 1
• Gene symbol: ATE1
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.13
• Summary: This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018958	hsa-miR-335-5p	Microarray	18185580
MIRT020247	hsa-miR-130b-3p	Sequencing	20371350
MIRT051987	hsa-let-7b-5p	CLASH	23622248
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804136	hsa-miR-141	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804138	hsa-miR-186	CLIP-seq
MIRT804139	hsa-miR-194	CLIP-seq
MIRT804140	hsa-miR-200a	CLIP-seq
MIRT804141	hsa-miR-219-1-3p	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804146	hsa-miR-3065-3p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT804148	hsa-miR-3662	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804150	hsa-miR-4682	CLIP-seq
MIRT804151	hsa-miR-4691-5p	CLIP-seq
MIRT804152	hsa-miR-4698	CLIP-seq
MIRT804153	hsa-miR-4719	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804155	hsa-miR-571	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq
MIRT1937493	hsa-miR-2355-5p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT1937494	hsa-miR-3713	CLIP-seq
MIRT1937495	hsa-miR-3924	CLIP-seq
MIRT1937496	hsa-miR-4427	CLIP-seq
MIRT1937497	hsa-miR-4724-5p	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IBA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IDA	34893540
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IEA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	TAS	9858543
GO:0005515	Function	Protein binding	IPI	23455924, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	9858543
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9858543
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0010498	Process	Proteasomal protein catabolic process	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IMP	25970626
GO:0016598	Process	Protein arginylation	NAS	9858543
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	34893540
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	34893540
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	34893540
GO:0071596	Process	Ubiquitin-dependent protein catabolic process via the N-end rule pathway	IDA	34893540

Other IDs

• MIM: 607103
• HGNC: 782
• e!Ensembl: ENSG00000107669

Protein

• UniProt ID: O95260
• Protein name: Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1)
• Protein function: Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein (PubMed:34893540). This arginylation is required for degradation of the protein via the ubiquitin pathway (PubMed:34893540). Does no
• PDB: 8TZV, 8UAU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04376	ATE_N	21 → 92	Arginine-tRNA-protein transferase, N terminus	Family
  PF04377	ATE_C	290 → 429	Arginine-tRNA-protein transferase, C terminus	Family

• Sequence:

  MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGK
  YVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
  DDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSG
  EPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPS
  LFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQM
  VIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILP
  NCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
  QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIM
  PYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

• Sequence length: 518

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
ATE1-related disorder	Benign; Likely benign	rs10886973, rs369126133, rs10749435, rs79570924, rs4237536, rs35350755, rs781663183, rs751448391, rs10886994	RCV003974447 RCV003904686 RCV003979848 RCV003982513 RCV003982323 RCV003977352 RCV003917084 RCV003976767 RCV003982080

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	33687501
Amyotrophic Lateral Sclerosis	Associate	33687501
Breast Neoplasms	Associate	25381249, 31125336
Cholangiocarcinoma	Associate	36635225
COVID 19	Stimulate	36851505
Melanoma	Associate	35561126
Neoplasms	Inhibit	33330934
Neoplasms	Associate	35561126