Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
111
Gene name Gene Name - the full gene name approved by the HGNC.
Adenylate cyclase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADCY5
Synonyms (NCBI Gene) Gene synonyms aliases
AC5, DSKOD, FDFM
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha sub
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61734561 C>G,T Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, synonymous variant, missense variant
rs548282891 C>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Missense variant, genic upstream transcript variant, coding sequence variant
rs746547282 C>T Likely-pathogenic Splice donor variant
rs757156390 G>A,C Pathogenic Missense variant, synonymous variant, coding sequence variant
rs765349480 C>G,T Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT720875 hsa-miR-4753-5p HITS-CLIP 19536157
MIRT720874 hsa-miR-4717-5p HITS-CLIP 19536157
MIRT720873 hsa-miR-3922-5p HITS-CLIP 19536157
MIRT720872 hsa-miR-6832-3p HITS-CLIP 19536157
MIRT720871 hsa-miR-4287 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001973 Process G protein-coupled adenosine receptor signaling pathway IEA
GO:0004016 Function Adenylate cyclase activity IBA
GO:0004016 Function Adenylate cyclase activity IDA 15385642, 24700542
GO:0004016 Function Adenylate cyclase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600293 236 ENSG00000173175
Protein
UniProt ID O95622
Protein name Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5) (AC5)
Protein function Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:15385642, PubMed:24700542, PubMed:26206488). Mediates signaling downstream of ADRB1 (PubMed:24700542). Regulates the increase of free cytosolic Ca(
PDB 8SL3 , 8SL4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16214 AC_N 1 458 Adenylyl cyclase N-terminal extracellular and transmembrane region Family
PF00211 Guanylate_cyc 460 642 Adenylate and Guanylate cyclase catalytic domain Domain
PF06327 DUF1053 668 761 Domain of Unknown Function (DUF1053) Family
PF00211 Guanylate_cyc 1062 1256 Adenylate and Guanylate cyclase catalytic domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in pancreas islets (at protein level). Expressed in the brain, with high expression in the corpus striatum (PubMed:26085604). {ECO:0000269|PubMed:24740569, ECO:0000269|PubMed:26085604}.
Sequence
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFH
KIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLI
LRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRF
GAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNG
GPPL
S
Sequence length 1261
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Purine metabolism
Metabolic pathways
Endocrine resistance
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Hormone signaling
Oocyte meiosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Apelin signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Thermogenesis
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Growth hormone synthesis, secretion and action
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Parkinson disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Dilated cardiomyopathy
  Glucagon signaling in metabolic regulation
PKA activation
PKA activation in glucagon signalling
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Adrenaline,noradrenaline inhibits insulin secretion
G alpha (s) signalling events
G alpha (z) signalling events
Vasopressin regulates renal water homeostasis via Aquaporins
Hedgehog 'off' state
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Dyskinesia, Limb And Orofacial Dyskinesia with orofacial involvement, autosomal dominant, Dyskinesia with orofacial involvement, autosomal recessive rs1576704514, rs1553726054, rs864309484, rs1576606182, rs796065306, rs1576606282, rs864309483, rs797045002, rs864309515, rs1365372289, rs1553751262, rs1576526285, rs910314734 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Body fat percentage and type 2 diabetes (pairwise), Mild age-related type 2 diabetes, Type 2 diabetes (adjusted for BMI) or polycystic ovary syndrome (pleiotropy), Type ii diabetes, Type 2 diabetes (adjusted for BMI), Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Type 2 diabetes, Diabetes, Body mass index and type 2 diabetes (pairwise) N/A N/A GWAS
Distal Myopathy With Posterior Leg And Anterior Hand Involvement distal myopathy with posterior leg and anterior hand involvement N/A N/A ClinVar
Heart Failure Heart failure N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35567329
Apraxia oculomotor Cogan type Associate 27061943
Breast Neoplasms Inhibit 35697697
Breast Neoplasms Associate 36705562
Carcinoma Intraductal Noninfiltrating Associate 35697697
Cardiomyopathy Dilated Associate 27427220
Cerebral Palsy Associate 28511835, 32647899
Chorea Associate 26085604, 26537056, 27061943, 28511835, 36054588
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress Associate 27061943
Colorectal Neoplasms Associate 35545337