Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11098
Gene name Gene Name - the full gene name approved by the HGNC.
Serine protease 23
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRSS23
Synonyms (NCBI Gene) Gene synonyms aliases
SIG13, SPUVE, ZSIG13
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a conserved member of the trypsin family of serine proteases. Mouse studies found a decrease of mRNA levels of this gene after ovulation was induced. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024605 hsa-miR-215-5p Microarray 19074876
MIRT026709 hsa-miR-192-5p Microarray 19074876
MIRT607120 hsa-miR-8485 HITS-CLIP 19536157
MIRT611736 hsa-miR-329-3p HITS-CLIP 19536157
MIRT611735 hsa-miR-362-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005634 Component Nucleus IDA
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618376 14370 ENSG00000150687
Protein
UniProt ID O95084
Protein name Serine protease 23 (EC 3.4.21.-) (Putative secreted protein Zsig13)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 143 368 Trypsin Domain
Sequence
MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLE
VSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGS
SGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDG
KTYVKGTQKLRVGFLKPKFKDGGRGANDSTSAMPEQMKFQWIRVKRTHVPKGWIKGNAND
IGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDE
TYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNGSPQDFNVAVR
ITPLKYAQ
ICYWIKGNYLDCREG
Sequence length 383
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glaucoma Glaucoma N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22291950
Carcinoma Renal Cell Associate 35508649, 38538287
Cell Transformation Neoplastic Associate 33800494
Dementia Associate 36421848
Fibrosis Associate 24386373
Glomerulonephritis IGA Associate 37908345
Melanoma Associate 29706638
Mesothelioma Malignant Associate 33800494
Myopathies Structural Congenital Associate 36189305
Neoplasm Metastasis Associate 38538287