ADAMTS8 (ADAM metallopeptidase with thrombospondin type 1 motif 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11095
Gene name Gene Name - the full gene name approved by the HGNC.
ADAM metallopeptidase with thrombospondin type 1 motif 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADAMTS8
Synonyms (NCBI Gene) Gene synonyms aliases
ADAM-TS8, METH2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(70)
miRTarBase ID miRNA Experiments Reference
MIRT650020 hsa-miR-4729 HITS-CLIP 23824327
MIRT650019 hsa-miR-5696 HITS-CLIP 23824327
MIRT650018 hsa-miR-579-3p HITS-CLIP 23824327
MIRT650017 hsa-miR-664b-3p HITS-CLIP 23824327
MIRT650016 hsa-miR-335-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0004222 Function Metalloendopeptidase activity IBA 21873635
GO:0005178 Function Integrin binding TAS 10438512
GO:0006508 Process Proteolysis IEA
GO:0008201 Function Heparin binding IEA
GO:0008237 Function Metallopeptidase activity TAS 10438512
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605175 224 ENSG00000134917
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UP79
Protein name A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAM-TS 8) (ADAM-TS8) (ADAMTS-8) (EC 3.4.24.-) (METH-2) (METH-8)
Protein function Has anti-angiogenic properties.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01562 Pep_M12B_propep 29 → 150 Reprolysin family propeptide Family
PF01421 Reprolysin 219 → 429 Reprolysin (M12B) family zinc metalloprotease Domain
PF17771 ADAM_CR_2 440 → 513 ADAM cysteine-rich domain Domain
PF00090 TSP_1 530 → 580 Thrombospondin type 1 domain Domain
PF05986 ADAM_spacer1 690 → 809 ADAM-TS Spacer 1 Family
PF19030 TSP1_ADAMTS 836 → 887 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult and fetal lung, lower expression in brain, placenta, heart, stomach and fetal brain and kidney.
Sequence 
MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAF
GKGFVLRLAPDDSFLAPEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCR
GLSGSFLLDGEEFTIQPQGAGGSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERG
DHQEDSEEESQEEEAEGASEPPPPLGATSRTKRFVSEARFVETLLVADASMAAFYGADLQ
NHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRF
NQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHT
LAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGG
HGDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTD
GAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSR
TCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
TDMDGNLLQWVPKYAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQ
CVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTNYGYNDIVTIPAGATNIDVKQ
RSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFR
PLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGD
WSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
Sequence length 889
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Defective B3GALTL causes Peters-plus syndrome (PpS)
O-glycosylation of TSR domain-containing proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 29610475
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Hypertension Hypertension GWAS
Glaucoma Glaucoma GWAS
Show/Hide Text Mining Associations (27)
Associations from Text Mining
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Inhibit 31473210
Asthma Associate 39293435
Brain Neoplasms Inhibit 16570050
Brain Neoplasms Associate 37587889
Carcinogenesis Associate 16570050
Carcinoma Ductal Breast Associate 29860265
Carcinoma Non Small Cell Lung Associate 15328519, 36202977
Carcinoma Non Small Cell Lung Inhibit 28410204
Cartilage Diseases Associate 18671975
Diabetes Mellitus Type 2 Associate 36339449