TRIM31 (tripartite motif containing 31)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11074
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 31
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM31
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf13, HCG1, HCGI, RNF
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by R
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(24)
miRTarBase ID miRNA Experiments Reference
MIRT496736 hsa-miR-3609 PAR-CLIP 22291592
MIRT496737 hsa-miR-548ah-5p PAR-CLIP 22291592
MIRT496735 hsa-miR-140-3p PAR-CLIP 22291592
MIRT496734 hsa-miR-520g-3p PAR-CLIP 22291592
MIRT496733 hsa-miR-520h PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0005515 Function Protein binding IPI 16189514, 25416956, 32296183, 32814053
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609316 16289 ENSG00000204616
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9BZY9
Protein name E3 ubiquitin-protein ligase TRIM31 (EC 2.3.2.27) (Tripartite motif-containing protein 31)
Protein function E3 ubiquitin-protein ligase that acts as a regulator of antiviral immune response and inflammation by mediating ubiquitination of substrates (PubMed:18773414, PubMed:27929086, PubMed:27992402). Acts as a regulator of innate immune defense agains
PDB 2YSJ , 2YSL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 → 56 Domain
PF00643 zf-B_box 90 → 131 B-box zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Up-regulated in gastric adenocarcinomas. {ECO:0000269|PubMed:18773414}.
Sequence 
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS
Sequence length 425
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (8)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer, Contralateral breast cancer vs unilateral breast cancer N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Myasthenia Gravis Myasthenia gravis N/A N/A GWAS
Show/Hide Text Mining Associations (20)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 21302343
Breast Neoplasms Associate 38263039
Carcinoma Hepatocellular Associate 29784950
Carcinoma Non Small Cell Lung Inhibit 24566900
Colitis Ulcerative Associate 18776587
Colorectal Neoplasms Associate 35999641
Crohn Disease Associate 18776587
Crohn Disease Inhibit 27216961
Gastrointestinal Neoplasms Associate 35970857
Hypertension Associate 32854392