Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11074
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 31
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM31
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf13, HCG1, HCGI, RNF
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by R

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT496736	hsa-miR-3609	PAR-CLIP	22291592
MIRT496737	hsa-miR-548ah-5p	PAR-CLIP	22291592
MIRT496735	hsa-miR-140-3p	PAR-CLIP	22291592
MIRT496734	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT496733	hsa-miR-520h	PAR-CLIP	22291592
MIRT496732	hsa-miR-593-5p	PAR-CLIP	22291592
MIRT496736	hsa-miR-3609	PAR-CLIP	22291592
MIRT496737	hsa-miR-548ah-5p	PAR-CLIP	22291592
MIRT496735	hsa-miR-140-3p	PAR-CLIP	22291592
MIRT496734	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT496733	hsa-miR-520h	PAR-CLIP	22291592
MIRT496732	hsa-miR-593-5p	PAR-CLIP	22291592
MIRT1922436	hsa-miR-199a-3p	CLIP-seq
MIRT1922437	hsa-miR-199b-3p	CLIP-seq
MIRT1922438	hsa-miR-3129-5p	CLIP-seq
MIRT1922439	hsa-miR-4264	CLIP-seq
MIRT1922440	hsa-miR-4639-3p	CLIP-seq
MIRT1922441	hsa-miR-4797-3p	CLIP-seq
MIRT1922442	hsa-miR-936	CLIP-seq
MIRT2136097	hsa-miR-520g	CLIP-seq
MIRT2136098	hsa-miR-548ah	CLIP-seq
MIRT2396354	hsa-miR-1236	CLIP-seq
MIRT2396355	hsa-miR-197	CLIP-seq
MIRT2396356	hsa-miR-412	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IEA
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IMP	18248090
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046597	Process	Negative regulation of viral entry into host cell	IMP	18248090
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IBA	21873635
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	23077300
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:1902186	Process	Regulation of viral release from host cell	IMP	18248090

MIM	HGNC	e!Ensembl
609316	16289	ENSG00000204616

Protein

UniProt ID

Q9BZY9

Protein name

E3 ubiquitin-protein ligase TRIM31 (EC 2.3.2.27) (Tripartite motif-containing protein 31)

Protein function

E3 ubiquitin-protein ligase that acts as a regulator of antiviral immune response and inflammation by mediating ubiquitination of substrates (PubMed:18773414, PubMed:27929086, PubMed:27992402). Acts as a regulator of innate immune defense agains

PDB

2YSJ , 2YSL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	90 → 131	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in gastric adenocarcinomas. {ECO:0000269|PubMed:18773414}.

Sequence

MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS

Sequence length

425

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Causal Diseases (10)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683
Dermatitis	Dermatitis, Irritant	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	27258892
Diabetes	Diabetes	rs80356611	31451708
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	31451708, 25936594, 17632545
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	19836008
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	22899653
Myasthenia gravis	Myasthenia Gravis	rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913 View all (8 more)	23055271
Prostate cancer	Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	25217961, 29892016
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	17804836, 19503088
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	28540026

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Major Depressive Disorder		29662059	ClinVar
Myasthenia Gravis	Myasthenia Gravis			GWAS
Takayasu Arteritis	Takayasu Arteritis			GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Psoriasis	Psoriasis			GWAS
Dental caries	Dental caries			GWAS
Insomnia	Insomnia			GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Attention Deficit Disorder with Hyperactivity	Associate	21302343
Breast Neoplasms	Associate	38263039
Carcinoma Hepatocellular	Associate	29784950
Carcinoma Non Small Cell Lung	Inhibit	24566900
Colitis Ulcerative	Associate	18776587
Colorectal Neoplasms	Associate	35999641
Crohn Disease	Associate	18776587
Crohn Disease	Inhibit	27216961
Gastrointestinal Neoplasms	Associate	35970857
Hypertension	Associate	32854392
Leukemia Myeloid Acute	Associate	32232394, 36094501
Lung Neoplasms	Inhibit	24566900
Mental Disorders	Associate	21302343
Nasopharyngeal Carcinoma	Associate	33311639
Neoplasm Metastasis	Inhibit	24566900
Neoplasms	Inhibit	24566900
Neoplasms	Associate	32232394, 35970857, 35999641, 37973999
Pulmonary Disease Chronic Obstructive	Associate	35999641
Signs and Symptoms Digestive	Associate	35970857
Stomach Neoplasms	Associate	37973999

TRIM31 (tripartite motif containing 31)