Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11074
Gene name	Tripartite motif containing 31
Gene symbol	TRIM31
Synonyms (NCBI Gene)	C6orf13HCG1HCGIRNF
Chromosome	6
Chromosome location	6p22.1
Summary	This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by R

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT496736	hsa-miR-3609	PAR-CLIP	22291592
MIRT496737	hsa-miR-548ah-5p	PAR-CLIP	22291592
MIRT496735	hsa-miR-140-3p	PAR-CLIP	22291592
MIRT496734	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT496733	hsa-miR-520h	PAR-CLIP	22291592
MIRT496732	hsa-miR-593-5p	PAR-CLIP	22291592
MIRT496736	hsa-miR-3609	PAR-CLIP	22291592
MIRT496737	hsa-miR-548ah-5p	PAR-CLIP	22291592
MIRT496735	hsa-miR-140-3p	PAR-CLIP	22291592
MIRT496734	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT496733	hsa-miR-520h	PAR-CLIP	22291592
MIRT496732	hsa-miR-593-5p	PAR-CLIP	22291592
MIRT1922436	hsa-miR-199a-3p	CLIP-seq
MIRT1922437	hsa-miR-199b-3p	CLIP-seq
MIRT1922438	hsa-miR-3129-5p	CLIP-seq
MIRT1922439	hsa-miR-4264	CLIP-seq
MIRT1922440	hsa-miR-4639-3p	CLIP-seq
MIRT1922441	hsa-miR-4797-3p	CLIP-seq
MIRT1922442	hsa-miR-936	CLIP-seq
MIRT2136097	hsa-miR-520g	CLIP-seq
MIRT2136098	hsa-miR-548ah	CLIP-seq
MIRT2396354	hsa-miR-1236	CLIP-seq
MIRT2396355	hsa-miR-197	CLIP-seq
MIRT2396356	hsa-miR-412	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	27992402
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	27929086
GO:0006954	Process	Inflammatory response	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019076	Process	Viral release from host cell	IMP	18248090
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	18248090
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IMP	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IDA	27992402
GO:0051607	Process	Defense response to virus	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	27929086, 27992402
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	27992402
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	27929086
GO:0140374	Process	Antiviral innate immune response	IDA	27992402
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IDA	27929086

MIM	HGNC	e!Ensembl
609316	16289	ENSG00000204616

Q9BZY9

Protein name

E3 ubiquitin-protein ligase TRIM31 (EC 2.3.2.27) (Tripartite motif-containing protein 31)

Protein function

E3 ubiquitin-protein ligase that acts as a regulator of antiviral immune response and inflammation by mediating ubiquitination of substrates (PubMed:18773414, PubMed:27929086, PubMed:27992402). Acts as a regulator of innate immune defense agains

PDB

2YSJ , 2YSL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	90 → 131	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in gastric adenocarcinomas. {ECO:0000269|PubMed:18773414}.

Sequence

MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS

Sequence length

425

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Gastric cancer	Likely benign; Benign	rs772682330, rs61758092	RCV005927430 RCV005911938
Malignant tumor of urinary bladder	Benign	rs61758092	RCV005911937

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Attention Deficit Disorder with Hyperactivity	Associate	21302343
Breast Neoplasms	Associate	38263039
Carcinoma Hepatocellular	Associate	29784950
Carcinoma Non Small Cell Lung	Inhibit	24566900
Colitis Ulcerative	Associate	18776587
Colorectal Neoplasms	Associate	35999641
Crohn Disease	Associate	18776587
Crohn Disease	Inhibit	27216961
Gastrointestinal Neoplasms	Associate	35970857
Hypertension	Associate	32854392
Leukemia Myeloid Acute	Associate	32232394, 36094501
Lung Neoplasms	Inhibit	24566900
Mental Disorders	Associate	21302343
Nasopharyngeal Carcinoma	Associate	33311639
Neoplasm Metastasis	Inhibit	24566900
Neoplasms	Inhibit	24566900
Neoplasms	Associate	32232394, 35970857, 35999641, 37973999
Pulmonary Disease Chronic Obstructive	Associate	35999641
Signs and Symptoms Digestive	Associate	35970857
Stomach Neoplasms	Associate	37973999

TRIM31 (tripartite motif containing 31)