Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11062
Gene name Gene Name - the full gene name approved by the HGNC.	Dihydrouridine synthase 4 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DUS4L
Synonyms (NCBI Gene) Gene synonyms aliases	DUS4, PP35
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.3

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023098	hsa-miR-124-3p	Microarray	18668037
MIRT947323	hsa-miR-1260	CLIP-seq
MIRT947324	hsa-miR-1260b	CLIP-seq
MIRT947325	hsa-miR-1283	CLIP-seq
MIRT947326	hsa-miR-1293	CLIP-seq
MIRT947327	hsa-miR-188-3p	CLIP-seq
MIRT947328	hsa-miR-216b	CLIP-seq
MIRT947329	hsa-miR-2278	CLIP-seq
MIRT947330	hsa-miR-3135	CLIP-seq
MIRT947331	hsa-miR-3145-5p	CLIP-seq
MIRT947332	hsa-miR-3152-5p	CLIP-seq
MIRT947333	hsa-miR-3156-3p	CLIP-seq
MIRT947334	hsa-miR-3618	CLIP-seq
MIRT947335	hsa-miR-3921	CLIP-seq
MIRT947336	hsa-miR-4301	CLIP-seq
MIRT947337	hsa-miR-4483	CLIP-seq
MIRT947338	hsa-miR-4649-3p	CLIP-seq
MIRT947339	hsa-miR-4653-5p	CLIP-seq
MIRT947340	hsa-miR-4773	CLIP-seq
MIRT947341	hsa-miR-4774-3p	CLIP-seq
MIRT947342	hsa-miR-508-5p	CLIP-seq
MIRT947343	hsa-miR-660	CLIP-seq
MIRT947344	hsa-miR-934	CLIP-seq
MIRT1980624	hsa-miR-1915	CLIP-seq
MIRT1980625	hsa-miR-193a-5p	CLIP-seq
MIRT947331	hsa-miR-3145-5p	CLIP-seq
MIRT1980626	hsa-miR-4314	CLIP-seq
MIRT1980627	hsa-miR-4726-3p	CLIP-seq
MIRT947342	hsa-miR-508-5p	CLIP-seq
MIRT1980628	hsa-miR-579	CLIP-seq
MIRT947344	hsa-miR-934	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002943	Process	TRNA dihydrouridine synthesis	IDA	34798057
GO:0002943	Process	TRNA dihydrouridine synthesis	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017150	Function	TRNA dihydrouridine synthase activity	IBA
GO:0017150	Function	TRNA dihydrouridine synthase activity	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0102266	Function	TRNA-dihydrouridine20a synthase activity	IEA
GO:0102267	Function	TRNA-dihydrouridine20b synthase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

O95620

Protein name

tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like (EC 1.3.1.90) (pp35) (tRNA-dihydrouridine synthase 4-like)

Protein function

Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01207	Dus	30 → 310	Dihydrouridine synthase (Dus)	Family

Sequence

MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIV
AADFVKSIKARDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRW
AMAEGYGACLINKPELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGV
SWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGDIRSLKEAENVWRITGTDGVMVA
RGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQHLMYMMEKITSRQEKRVFNA
LSSTSAIIDYLTDHYGI

Sequence length

317

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Osteoarthritis	Associate	24825461
Osteoarthritis Knee	Associate	36089590
Stomach Neoplasms	Associate	28415823

DUS4L (dihydrouridine synthase 4 like)