Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11052
Gene name Gene Name - the full gene name approved by the HGNC.
Cleavage and polyadenylation specific factor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CPSF6
Synonyms (NCBI Gene) Gene synonyms aliases
CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q15
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one subunit of a cleavage factor required for 3` RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3` end processing complex and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024266 hsa-miR-215-5p Microarray 19074876
MIRT026674 hsa-miR-192-5p Microarray 19074876
MIRT049065 hsa-miR-92a-3p CLASH 23622248
MIRT609721 hsa-miR-8485 HITS-CLIP 23313552
MIRT609720 hsa-miR-329-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 15169763
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604979 13871 ENSG00000111605
Protein
UniProt ID Q16630
Protein name Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPB
Protein function Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs (PubMed:14690600, PubMed:29276085, Pub
PDB 3P5T , 3P6Y , 3Q2S , 3Q2T , 4B4N , 4U0A , 4U0B , 4WYM , 6AY9 , 6GX9 , 7SNQ , 7ZUD , 8CL1 , 8EJL , 8GDV , 9CNV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 83 154 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTV
GDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRAN
GQSKGFALVGVGSEASSKKLMDLLPKRELHGQNP
VVTPCNKQFLSQFEMQSRKTTQSGQM
SGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPP
LGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV
PGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPA
FFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNR
NRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGI
ESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDR
ERDREREYRHR
Sequence length 551
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  mRNA surveillance pathway
Viral life cycle - HIV-1
  Signaling by cytosolic FGFR1 fusion mutants
Signaling by FGFR1 in disease
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carpal Tunnel Syndrome Carpal tunnel syndrome N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Neurodevelopmental Disorders neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36446361
Breast Neoplasms Associate 36446361
Carcinoma Hepatocellular Associate 34217312
HIV Infections Associate 26994143, 36202818
Leukemia Myeloid Acute Associate 29891591
Neoplasms Associate 22813749, 36446361, 37777964
Prostatic Neoplasms Castration Resistant Associate 25189356