Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11044
Gene name Gene Name - the full gene name approved by the HGNC.	Terminal nucleotidyltransferase 4A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TENT4A
Synonyms (NCBI Gene) Gene synonyms aliases	LAK-1, LAK1, PAPD7, POLK, POLS, TRF4, TRF4-1, TRF41, TUTASE5
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p15.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. Alternatively spliced transcript variants that encode different isoforms have been

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10066793
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006302	Process	Double-strand break repair	NAS	10066793
GO:0006397	Process	MRNA processing	IEA
GO:0007062	Process	Sister chromatid cohesion	TAS	10066793
GO:0007076	Process	Mitotic chromosome condensation	NAS	10066793
GO:0009410	Process	Response to xenobiotic stimulus	IDA	10066793
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0031123	Process	RNA 3'-end processing	IBA
GO:0031499	Component	TRAMP complex	IBA
GO:0031965	Component	Nuclear membrane	IDA
GO:0043221	Function	SMC family protein binding	TAS	10066793
GO:0043634	Process	Polyadenylation-dependent ncRNA catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0060212	Process	Negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IEA
GO:0060212	Process	Negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IMP	30026317
GO:0070568	Function	Guanylyltransferase activity	IEA
GO:0070568	Function	Guanylyltransferase activity	IMP	30026317
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IEA
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	30026317
GO:1990817	Function	Poly(A) RNA polymerase activity	IBA
GO:1990817	Function	Poly(A) RNA polymerase activity	IEA

MIM	HGNC	e!Ensembl
605198	16705	ENSG00000112941

Protein

UniProt ID

Q5XG87

Protein name

Terminal nucleotidyltransferase 4A (DNA polymerase sigma) (LAK-1) (Non-canonical poly(A) RNA polymerase PAPD7) (EC 2.7.7.19) (PAP-associated domain-containing protein 7) (TRAMP-like complex polyadenylate polymerase) (Terminal guanylyltransferase) (EC 2.7.

Protein function

Terminal nucleotidyltransferase that catalyzes preferentially the transfer of ATP and GTP on RNA 3' poly(A) tail creating a heterogeneous 3' poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation (PubMed:233760

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01909	NTP_transf_2	245 → 354	Nucleotidyltransferase domain	Family
PF03828	PAP_assoc	408 → 468	Cid1 family poly A polymerase	Family

Sequence

MQIWETSQGVGRGGSGFASYFCLNSPALDTAAAAGAAGRGSGGLGPALPAASPPPPGPTA
PAALPPALLTALGPAAEGARRLHKSPSLSSSSSSSSSNAESGTESPGCSSSSSSSASLGR
PGGGRGGAFFNFADGAPSAPGTANGHPGPRGPAPAGSPSQHQFHPGRRKRENKASTYGLN
YLLSGSRAAALSGGGGPGAQAPRPGTPWKSRAYSPGIQGLHEEIIDFYNFMSPCPEEAAM
RREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK
HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYL
ILVLKQFLLQRDLNEVFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELY
GRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQV
KQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSP
GMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDV
DSDTPPCTTPSVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPP
PTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGS
HGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR

Sequence length

772

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		Signaling by BRAF and RAF fusions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Dyskeratosis Congenita	Associate	32559291
Hepatitis B	Associate	32559291
Melanoma	Associate	3598463
Neoplasms	Associate	1700922
Stomach Neoplasms	Associate	33746573
Uterine Cervical Neoplasms	Associate	18559093

TENT4A (terminal nucleotidyltransferase 4A)