Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11033
Gene name	ArfGAP with dual PH domains 1
Gene symbol	ADAP1
Synonyms (NCBI Gene)	CENTA1GCS1Lp42IP4
Chromosome	7
Chromosome location	7p22.3

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT513371	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT513368	hsa-miR-4679	PAR-CLIP	20371350
MIRT513367	hsa-miR-7974	PAR-CLIP	20371350
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	20371350
MIRT513365	hsa-miR-647	PAR-CLIP	20371350
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	20371350
MIRT513363	hsa-miR-8070	PAR-CLIP	20371350
MIRT513371	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT531694	hsa-miR-5680	PAR-CLIP	22012620
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	22012620
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT513368	hsa-miR-4679	PAR-CLIP	22012620
MIRT513367	hsa-miR-7974	PAR-CLIP	22012620
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	22012620
MIRT513365	hsa-miR-647	PAR-CLIP	22012620
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	22012620
MIRT513363	hsa-miR-8070	PAR-CLIP	22012620
MIRT513371	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	23446348
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	23446348
MIRT513368	hsa-miR-4679	PAR-CLIP	23446348
MIRT513367	hsa-miR-7974	PAR-CLIP	23446348
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	23446348
MIRT513365	hsa-miR-647	PAR-CLIP	23446348
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	23446348
MIRT513363	hsa-miR-8070	PAR-CLIP	23446348
MIRT513371	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT513368	hsa-miR-4679	PAR-CLIP	20371350
MIRT513367	hsa-miR-7974	PAR-CLIP	20371350
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	20371350
MIRT513365	hsa-miR-647	PAR-CLIP	20371350
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	20371350
MIRT513363	hsa-miR-8070	PAR-CLIP	20371350
MIRT513371	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT531694	hsa-miR-5680	PAR-CLIP	22012620
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	22012620
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT513368	hsa-miR-4679	PAR-CLIP	22012620
MIRT513367	hsa-miR-7974	PAR-CLIP	22012620
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	22012620
MIRT513365	hsa-miR-647	PAR-CLIP	22012620
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	22012620
MIRT513363	hsa-miR-8070	PAR-CLIP	22012620
MIRT513371	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT513370	hsa-miR-3614-5p	PAR-CLIP	23446348
MIRT513369	hsa-miR-6500-3p	PAR-CLIP	23446348
MIRT513368	hsa-miR-4679	PAR-CLIP	23446348
MIRT513367	hsa-miR-7974	PAR-CLIP	23446348
MIRT513366	hsa-miR-4687-3p	PAR-CLIP	23446348
MIRT513365	hsa-miR-647	PAR-CLIP	23446348
MIRT513364	hsa-miR-6842-3p	PAR-CLIP	23446348
MIRT513363	hsa-miR-8070	PAR-CLIP	23446348
MIRT767010	hsa-miR-1224-5p	CLIP-seq
MIRT767011	hsa-miR-125a-3p	CLIP-seq
MIRT767012	hsa-miR-125a-5p	CLIP-seq
MIRT767013	hsa-miR-125b	CLIP-seq
MIRT767014	hsa-miR-146b-3p	CLIP-seq
MIRT767015	hsa-miR-1915	CLIP-seq
MIRT767016	hsa-miR-3150b-3p	CLIP-seq
MIRT767017	hsa-miR-3151	CLIP-seq
MIRT767018	hsa-miR-3173-5p	CLIP-seq
MIRT767019	hsa-miR-361-3p	CLIP-seq
MIRT767020	hsa-miR-3665	CLIP-seq
MIRT767021	hsa-miR-371b-3p	CLIP-seq
MIRT767022	hsa-miR-3918	CLIP-seq
MIRT767023	hsa-miR-4319	CLIP-seq
MIRT767024	hsa-miR-4640-5p	CLIP-seq
MIRT767025	hsa-miR-4685-5p	CLIP-seq
MIRT767026	hsa-miR-4689	CLIP-seq
MIRT767027	hsa-miR-4691-5p	CLIP-seq
MIRT767028	hsa-miR-4710	CLIP-seq
MIRT767029	hsa-miR-4726-5p	CLIP-seq
MIRT767030	hsa-miR-4749-3p	CLIP-seq
MIRT767031	hsa-miR-4751	CLIP-seq
MIRT767032	hsa-miR-4784	CLIP-seq
MIRT767033	hsa-miR-544b	CLIP-seq
MIRT767034	hsa-miR-665	CLIP-seq
MIRT767035	hsa-miR-766	CLIP-seq
MIRT767036	hsa-miR-874	CLIP-seq
MIRT1925931	hsa-miR-1225-3p	CLIP-seq
MIRT767015	hsa-miR-1915	CLIP-seq
MIRT1925932	hsa-miR-214	CLIP-seq
MIRT767019	hsa-miR-361-3p	CLIP-seq
MIRT1925933	hsa-miR-3619-5p	CLIP-seq
MIRT1925934	hsa-miR-3664-3p	CLIP-seq
MIRT767021	hsa-miR-371b-3p	CLIP-seq
MIRT767022	hsa-miR-3918	CLIP-seq
MIRT1925935	hsa-miR-3943	CLIP-seq
MIRT1925936	hsa-miR-4291	CLIP-seq
MIRT1925937	hsa-miR-4308	CLIP-seq
MIRT1925938	hsa-miR-4436a	CLIP-seq
MIRT1925939	hsa-miR-4505	CLIP-seq
MIRT767025	hsa-miR-4685-5p	CLIP-seq
MIRT1925940	hsa-miR-4757-5p	CLIP-seq
MIRT1925941	hsa-miR-761	CLIP-seq
MIRT1925942	hsa-miR-922	CLIP-seq
MIRT2167280	hsa-miR-103a	CLIP-seq
MIRT2167281	hsa-miR-107	CLIP-seq
MIRT2167282	hsa-miR-15a	CLIP-seq
MIRT2167283	hsa-miR-15b	CLIP-seq
MIRT2167284	hsa-miR-16	CLIP-seq
MIRT2167285	hsa-miR-195	CLIP-seq
MIRT1925932	hsa-miR-214	CLIP-seq
MIRT1925933	hsa-miR-3619-5p	CLIP-seq
MIRT2167286	hsa-miR-424	CLIP-seq
MIRT2167287	hsa-miR-4254	CLIP-seq
MIRT1925936	hsa-miR-4291	CLIP-seq
MIRT2167288	hsa-miR-4691-3p	CLIP-seq
MIRT2167289	hsa-miR-497	CLIP-seq
MIRT1925941	hsa-miR-761	CLIP-seq
MIRT1925942	hsa-miR-922	CLIP-seq
MIRT1925934	hsa-miR-3664-3p	CLIP-seq
MIRT1925938	hsa-miR-4436a	CLIP-seq
MIRT767024	hsa-miR-4640-5p	CLIP-seq
MIRT767029	hsa-miR-4726-5p	CLIP-seq
MIRT1925940	hsa-miR-4757-5p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10333475, 10448098
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	12893243, 21057110, 25416956, 32296183
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IBA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005634	Component	Nucleus	IDA	10333475, 10448098
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10333475, 10448098
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10333475, 10448098
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10333475
GO:0008270	Function	Zinc ion binding	IEA
GO:0043087	Process	Regulation of GTPase activity	IMP	10333475
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	IEA
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	TAS	12018390
GO:0046872	Function	Metal ion binding	IEA
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	IEA

MIM	HGNC	e!Ensembl
608114	16486	ENSG00000105963

O75689

Protein name

Arf-GAP with dual PH domain-containing protein 1 (Centaurin-alpha-1) (Cnt-a1) (Putative MAPK-activating protein PM25)

Protein function

GTPase-activating protein for the ADP ribosylation factor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). Regulates the incorporation of CD63 and CD9 into multivesicula

PDB

3FEH , 3FM8 , 3LJU , 3MDB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01412	ArfGap	6 → 122	Putative GTPase activating protein for Arf	Domain
PF00169	PH	130 → 229	PH domain	Domain
PF00169	PH	253 → 356	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at highest levels in brain and at lower levels in peripheral blood leukocytes. {ECO:0000269|PubMed:10448098}.

Sequence

MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIY
PEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGA
GDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPML
PQEYAVEAHFKHKP

Sequence length

374

Interactions

View interactions

	Reactome
			Nuclear signaling by ERBB4

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	30423315	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	31293054, 35702822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm Metastasis	Associate	31293054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30423315	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAP1 (ArfGAP with dual PH domains 1)