Gene Gene information from NCBI Gene database.
Entrez ID 11030
Gene name RNA binding protein, mRNA processing factor
Gene symbol RBPMS
Synonyms (NCBI Gene)
HERMES
Chromosome 8
Chromosome location 8p12
Summary This gene encodes a member of the RNA recognition motif family of RNA-binding proteins. The RNA recognition motif is between 80-100 amino acids in length and family members contain one to four copies of the motif. The RNA recognition motif consists of two
miRNA miRNA information provided by mirtarbase database.
409
miRTarBase ID miRNA Experiments Reference
MIRT022396 hsa-miR-124-3p Microarray 18668037
MIRT027579 hsa-miR-98-5p Microarray 19088304
MIRT718577 hsa-miR-6128 HITS-CLIP 19536157
MIRT718576 hsa-miR-6505-5p HITS-CLIP 19536157
MIRT731644 hsa-miR-21-3p Luciferase reporter assay 27166999
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IEA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome ISS
GO:0000932 Component P-body IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003713 Function Transcription coactivator activity IDA 17099224
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601558 19097 ENSG00000157110
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q93062
Protein name RNA-binding protein with multiple splicing (RBP-MS) (RBPMS) (Heart and RRM expressed sequence) (Hermes)
Protein function [Isoform A]: RNA binding protein that mediates the regulation of pre-mRNA alternative splicing (AS) (PubMed:24860013, PubMed:26347403). Acts either as activator (FLNB, HSPG2, LIPA1, MYOCD, PTPRF and PPFIBP1) or repressor (TPM1, ACTN1, ITGA7, PIE
PDB 5CYJ , 5DET
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 26 89 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, at various levels depending on the isoform and the tissue (PubMed:8855282). Strongly expressed in the heart, prostate, small intestine, large intestine, and ovary; moderately expressed in the placenta, lung, liv
Sequence
MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK
QPVGFVSFDSRSEAEAAKNALNGIRFDPE
IPQTLRLEFAKANTKMAKNKLVGTPNPSTPL
PNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWL
PPSEATSQGWKSRQFC
Sequence length 196
Interactions View interactions