Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11023
Gene name Gene Name - the full gene name approved by the HGNC.
Ventral anterior homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VAX1
Synonyms (NCBI Gene) Gene synonyms aliases
MCOPS11
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, cal
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387907252 G>T Pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT736747 hsa-miR-7-1-3p Immunohistochemistry (IHC), qRT-PCR, In situ hybridization 32762844
MIRT1483143 hsa-miR-1470 CLIP-seq
MIRT1483144 hsa-miR-384 CLIP-seq
MIRT1483145 hsa-miR-4446-5p CLIP-seq
MIRT1483146 hsa-miR-4667-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604294 12660 ENSG00000148704
Protein
UniProt ID Q5SQQ9
Protein name Ventral anterior homeobox 1
Protein function Transcription factor that may function in dorsoventral specification of the forebrain. Required for axon guidance and major tract formation in the developing forebrain. May contribute to the differentiation of the neuroretina, pigmented epitheli
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 101 157 Homeodomain Domain
Sequence
MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDC
NKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQ
RCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK
DQGKDSELRSVVSETAATCSVLR
LLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAPGPAGAA
SPHPPAVGGAPGPGPAGPGGLHAGAPAAGHSLFSLPVPSLLGSVASRLSSAPLTMAGSLA
GNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD
Sequence length 334
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Syndromic microphthalmia microphthalmia, syndromic 11 rs387907252 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 22143938
Agenesis of Corpus Callosum Associate 22095910
Anophthalmia with pulmonary hypoplasia Associate 22095910
Anophthalmos Associate 22095910
Astrocytoma Associate 33051600
Carcinogenesis Associate 33941222
Cleft Lip Associate 22095910, 23679094, 27321816, 28662356, 33132092
Cleft Palate Associate 23679094, 25081408, 27369588, 28008912, 28383424, 30638414, 31122291, 33132092, 35419918
Microphthalmos Associate 22095910
Orofacial Cleft 1 Associate 22095910, 23463464, 23679094, 27527345, 28383424, 33132092