Gene Gene information from NCBI Gene database.
Entrez ID 11009
Gene name Interleukin 24
Gene symbol IL24
Synonyms (NCBI Gene)
C49AFISPIL10BMDA7MOB5ST16
Chromosome 1
Chromosome location 1q32.1
Summary This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of
miRNA miRNA information provided by mirtarbase database.
188
miRTarBase ID miRNA Experiments Reference
MIRT005563 hsa-miR-205-5p Luciferase reporter assayqRT-PCRWestern blot 20737563
MIRT005563 hsa-miR-205-5p Luciferase reporter assayqRT-PCRWestern blot 20737563
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT005563 hsa-miR-205-5p Luciferase reporter assay 23212344
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
CEBPB Unknown 10942517
JUN Unknown 21357535
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 25640309
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604136 11346 ENSG00000162892
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13007
Protein name Interleukin-24 (IL-24) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Suppression of tumorigenicity 16 protein)
Protein function Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis (PubMed:25168428, PubMed:27687232). Possesses antiviral functions and induces the type I inter
PDB 6DF3 , 6GG1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Up-regulated in melanoma cells induced to terminally differentiate.
Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
Sequence length 206
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
  Interleukin-20 family signaling