Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11009
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 24
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL24
Synonyms (NCBI Gene) Gene synonyms aliases
C49A, FISP, IL10B, MDA7, MOB5, ST16
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005563 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT005563 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT005563 hsa-miR-205-5p Luciferase reporter assay 23212344
Transcription factors
Transcription factor Regulation Reference
CEBPB Unknown 10942517
JUN Unknown 21357535
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 25640309
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IEA
GO:0006915 Process Apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604136 11346 ENSG00000162892
Protein
UniProt ID Q13007
Protein name Interleukin-24 (IL-24) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Suppression of tumorigenicity 16 protein)
Protein function Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis (PubMed:25168428, PubMed:27687232). Possesses antiviral functions and induces the type I inter
PDB 6DF3 , 6GG1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Up-regulated in melanoma cells induced to terminally differentiate.
Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
Sequence length 206
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
  Interleukin-20 family signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
16298037, 21671747
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
21671747, 16298037
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 12830052, 15713900
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
16298037, 21671747
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 19087313 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Juvenile Associate 23094074
Arthritis Rheumatoid Associate 26968800
Asthma Associate 19710636
Atherosclerosis Associate 24552169
Brain Neoplasms Inhibit 25091574
Breast Neoplasms Associate 12907143, 15851011, 16710719, 21546925, 28187446, 29749438, 30424508, 36766731
Burkitt Lymphoma Associate 29415639
Calcinosis Associate 29330517
Carcinoma Hepatocellular Associate 16586551, 20872968, 22899557, 26320498, 26361419, 27528029
Carcinoma Hepatocellular Inhibit 29484443