Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11009
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 24
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL24
Synonyms (NCBI Gene) Gene synonyms aliases
C49A, FISP, IL10B, MDA7, MOB5, ST16
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005563 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT005563 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT006858 hsa-miR-203a-3p Luciferase reporter assay 22917968
MIRT005563 hsa-miR-205-5p Luciferase reporter assay 23212344
Transcription factors
Transcription factor Regulation Reference
CEBPB Unknown 10942517
JUN Unknown 21357535
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 25640309
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604136 11346 ENSG00000162892
Protein
UniProt ID Q13007
Protein name Interleukin-24 (IL-24) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Suppression of tumorigenicity 16 protein)
Protein function Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis (PubMed:25168428, PubMed:27687232). Possesses antiviral functions and induces the type I inter
PDB 6DF3 , 6GG1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Up-regulated in melanoma cells induced to terminally differentiate.
Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
Sequence length 206
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
  Interleukin-20 family signaling
<