Gene Gene information from NCBI Gene database.
Entrez ID 10964
Gene name Interferon induced protein 44 like
Gene symbol IFI44L
Synonyms (NCBI Gene)
C1orf29GS3686TLDC5B
Chromosome 1
Chromosome location 1p31.1
miRNA miRNA information provided by mirtarbase database.
802
miRTarBase ID miRNA Experiments Reference
MIRT021253 hsa-miR-146a-5p Microarray 18057241
MIRT022604 hsa-miR-124-3p Microarray 18668037
MIRT619106 hsa-miR-34b-3p HITS-CLIP 23824327
MIRT637235 hsa-miR-1248 HITS-CLIP 23824327
MIRT619105 hsa-miR-7110-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006955 Process Immune response IBA
GO:0051607 Process Defense response to virus IDA 21478870
GO:0051607 Process Defense response to virus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613975 17817 ENSG00000137959
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q53G44
Protein name Interferon-induced protein 44-like
Protein function Type I interferon-stimulated gene (ISG) that plays a critical role in antiviral and antibacterial activity (PubMed:34722780). During bacterial infection, promotes macrophage differentiation and facilitates inflammatory cytokine secretion (PubMed
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01926 MMR_HSR1 199 359 50S ribosome-binding GTPase Family
Sequence
MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNM
IVAFMLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTD
IFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNR
LLADIRDYRPYADLVSEIRILLVGPVGSGKSSFFNSVKSIFHGHVTGQAVVGSDITSITE
RYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIPHILKGCMPDRYQFNSRKPIT
PEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCGIAYVALLTK
V
DDCSEVLQDNFLNMSRSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILS
ALRQMLRAADDFLEDLPLEETGAIERALQPCI
Sequence length 452
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs34615115 RCV005906264
Clear cell carcinoma of kidney Benign rs34615115 RCV005906265
Colon adenocarcinoma Uncertain significance rs372837467 RCV005928942
Multisystem inflammatory syndrome in children risk factor rs115901054 RCV001779434
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Febrile Encephalopathy Associate 31409879
Antiphospholipid Syndrome Associate 30471352
Arthritis Rheumatoid Associate 26787370, 35566100, 36189314
Autoimmune Diseases Associate 26787370
Autoimmune Diseases of the Nervous System Associate 35798818
Bacterial Infections Associate 31409879, 36189314
Bipolar Disorder Associate 24280982
Carcinoma Squamous Cell Associate 34504628
Congenital heart block Associate 28626076
Cough Associate 28842514