Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10963
Gene name Gene Name - the full gene name approved by the HGNC.
Stress induced phosphoprotein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STIP1
Synonyms (NCBI Gene) Gene synonyms aliases
HEL-S-94n, HOP, IEF-SSP-3521, P60, STI1, STI1L
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substra
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032016 hsa-miR-16-5p Proteomics 18668040
MIRT051957 hsa-let-7b-5p CLASH 23622248
MIRT047040 hsa-miR-183-5p CLASH 23622248
MIRT044894 hsa-miR-193a-3p CLASH 23622248
MIRT041679 hsa-miR-484 CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
HSF1 Unknown 20692357;22669480
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 20029029, 21044950, 21170051, 21360678, 23349634, 23431407, 24880080, 25036637, 27353360, 28330616, 28514442, 31980649, 32814053, 33961781, 35140242, 35271311
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 1569099, 16130169
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605063 11387 ENSG00000168439
Protein
UniProt ID P31948
Protein name Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)
Protein function Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 (By similarity).
PDB 1ELR , 1ELW , 2LNI , 2NC9 , 3ESK , 3FWV , 7KW7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17830 STI1 130 184 STI1 domain Domain
PF13181 TPR_8 261 291 Tetratricopeptide repeat Repeat
PF00515 TPR_1 300 332 Tetratricopeptide repeat Repeat
PF00515 TPR_1 360 393 Tetratricopeptide repeat Repeat
PF00515 TPR_1 394 427 Tetratricopeptide repeat Repeat
PF17830 STI1 482 536 STI1 domain Domain
Sequence
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
VLLG
VDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRT
PDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKD
AKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTF
IKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
Sequence length 543
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Prion disease   HSP90 chaperone cycle for steroid hormone receptors (SHR)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenomyosis Associate 29304094, 29673672
Amyloid Neuropathies Associate 24828240
Asthma Associate 33208131
Attention Deficit Disorder with Hyperactivity Associate 21784300
Breast Neoplasms Associate 27026610
Carcinoma Hepatocellular Associate 30138346
Carcinoma Renal Cell Associate 28199984
Carcinoma Squamous Cell Associate 28186972
Cholangiocarcinoma Associate 25034945
Chronobiology Disorders Associate 21784300