SEC61B (SEC61 translocon subunit beta)

Gene

• Entrez ID: 10952
• Gene name: SEC61 translocon subunit beta
• Gene symbol: SEC61B
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q22.33
• Summary: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER mem

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021708	hsa-miR-133a-3p	Microarray	21396852
MIRT043126	hsa-miR-324-5p	CLASH	23622248
MIRT2323328	hsa-miR-1237	CLIP-seq
MIRT2323329	hsa-miR-1245b-3p	CLIP-seq
MIRT2323330	hsa-miR-1248	CLIP-seq
MIRT2323331	hsa-miR-133a	CLIP-seq
MIRT2323332	hsa-miR-133b	CLIP-seq
MIRT2323333	hsa-miR-3134	CLIP-seq
MIRT2323334	hsa-miR-3942-3p	CLIP-seq
MIRT2323335	hsa-miR-4662a-5p	CLIP-seq
MIRT2323336	hsa-miR-4691-5p	CLIP-seq
MIRT2323337	hsa-miR-4778-3p	CLIP-seq
MIRT2323338	hsa-miR-561	CLIP-seq
MIRT2619182	hsa-miR-3120-3p	CLIP-seq
MIRT2619183	hsa-miR-3161	CLIP-seq
MIRT2619184	hsa-miR-331-3p	CLIP-seq
MIRT2619185	hsa-miR-3607-3p	CLIP-seq
MIRT2619186	hsa-miR-3647-3p	CLIP-seq
MIRT2619187	hsa-miR-371b-5p	CLIP-seq
MIRT2619188	hsa-miR-4275	CLIP-seq
MIRT2619189	hsa-miR-4282	CLIP-seq
MIRT2619190	hsa-miR-4698	CLIP-seq
MIRT2619191	hsa-miR-513a-3p	CLIP-seq
MIRT2619192	hsa-miR-600	CLIP-seq
MIRT2619193	hsa-miR-605	CLIP-seq
MIRT2619194	hsa-miR-944	CLIP-seq
MIRT2619182	hsa-miR-3120-3p	CLIP-seq
MIRT2619183	hsa-miR-3161	CLIP-seq
MIRT2619184	hsa-miR-331-3p	CLIP-seq
MIRT2619185	hsa-miR-3607-3p	CLIP-seq
MIRT2619186	hsa-miR-3647-3p	CLIP-seq
MIRT2619187	hsa-miR-371b-5p	CLIP-seq
MIRT2619188	hsa-miR-4275	CLIP-seq
MIRT2619189	hsa-miR-4282	CLIP-seq
MIRT2619190	hsa-miR-4698	CLIP-seq
MIRT2690336	hsa-miR-4768-5p	CLIP-seq
MIRT2619191	hsa-miR-513a-3p	CLIP-seq
MIRT2619192	hsa-miR-600	CLIP-seq
MIRT2619193	hsa-miR-605	CLIP-seq
MIRT2619194	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005515	Function	Protein binding	IPI	9792704, 17380188, 18555783, 19121997, 19675567, 21866104, 30021884, 32820719, 33845483, 35271311, 36217030
GO:0005783	Component	Endoplasmic reticulum	IDA	18555783
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005784	Component	Sec61 translocon complex	IBA
GO:0005784	Component	Sec61 translocon complex	IDA	31831667
GO:0005784	Component	Sec61 translocon complex	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	27044890
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006616	Process	SRP-dependent cotranslational protein targeting to membrane, translocation	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	22375059
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	8107851
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	17215517
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IBA
GO:0031205	Component	Endoplasmic reticulum Sec complex	ISS
GO:0036503	Process	ERAD pathway	IDA	8945469
GO:0043022	Function	Ribosome binding	IDA	32820719
GO:0043022	Function	Ribosome binding	IEA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IDA	17707796
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0048408	Function	Epidermal growth factor binding	IPI	19602593

Other IDs

• MIM: 609214
• HGNC: 16993
• e!Ensembl: ENSG00000106803

Protein

• UniProt ID: P60468
• Protein name: Protein transport protein Sec61 subunit beta
• Protein function: Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (PubMed:12475939). Forms a ribosome receptor and a gated pore in the ER membr
• PDB: 6W6L, 8B6L, 8DNV, 8DNW, 8DNX, 8DNY, 8DNZ, 8DO0, 8DO1, 8DO2, 8DO3, 8OJ0, 8OJ8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03911	Sec61_beta	51 → 91	Sec61beta family	Family

• Sequence:

  MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
  EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

• Sequence length: 96

Pathways

KEGG:

Protein export
Protein processing in endoplasmic reticulum
Phagosome
Vibrio cholerae infection

Reactome:

Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT POLYCYSTIC LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE 1	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	35766008	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	22710939	★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Associate	36573973	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	22710939	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24997997	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Associate	30135240	★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Associate	30135240	★☆☆☆☆ Found in Text Mining only