Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10950
Gene name Gene Name - the full gene name approved by the HGNC.
BTG anti-proliferation factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BTG3
Synonyms (NCBI Gene) Gene synonyms aliases
ANA, ANA/BTG3, APRO4, TOB5, TOB55, TOFA
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019633 hsa-miR-340-5p Sequencing 20371350
MIRT020163 hsa-miR-130b-3p Sequencing 20371350
MIRT020477 hsa-miR-106b-5p Microarray 17242205
MIRT002592 hsa-miR-124-3p Microarray 18668037
MIRT002592 hsa-miR-124-3p Microarray 15685193
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 18590053
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17690688
GO:0005634 Component Nucleus IBA 21873635
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005737 Component Cytoplasm IDA 9632145
GO:0008285 Process Negative regulation of cell population proliferation IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605674 1132 ENSG00000154640
Protein
UniProt ID Q14201
Protein name Protein BTG3 (Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
Protein function Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07742 BTG 1 115 BTG family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO:0000269|PubMed:9067576}.
Sequence
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVA
SFENK
DENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFP
PLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDR
NHWINPHMLAPH
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  RNA degradation  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 27989131
Papillary renal carcinoma Papillary Renal Cell Carcinoma rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724 19221000
Renal carcinoma Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney rs121913668, rs121913670, rs121913243, rs786202724 19221000
Unknown
Disease term Disease name Evidence References Source
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma 19221000 ClinVar
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 26700996
Arthritis Rheumatoid Associate 18283522, 35045800
Breast Neoplasms Inhibit 18590053
Carcinogenesis Inhibit 18590053
Carcinogenesis Associate 23419616, 23533280, 23657964, 28407690
Carcinoma Hepatocellular Associate 24147003
Carcinoma Ovarian Epithelial Associate 23657964
Carcinoma Renal Cell Inhibit 19221000
Colorectal Neoplasms Associate 28407690
Colorectal Neoplasms Inhibit 29270670