BTG3 (BTG anti-proliferation factor 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10950
Gene name Gene Name - the full gene name approved by the HGNC.
BTG anti-proliferation factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BTG3
Synonyms (NCBI Gene) Gene synonyms aliases
ANA, ANA/BTG3, APRO4, TOB5, TOB55, TOFA
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two t
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(441)
miRTarBase ID miRNA Experiments Reference
MIRT019633 hsa-miR-340-5p Sequencing 20371350
MIRT020163 hsa-miR-130b-3p Sequencing 20371350
MIRT020477 hsa-miR-106b-5p Microarray 17242205
MIRT002592 hsa-miR-124-3p Microarray 18668037
MIRT002592 hsa-miR-124-3p Microarray 15685193
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
TP53 Unknown 18590053
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17690688
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 9632145
GO:0008285 Process Negative regulation of cell population proliferation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605674 1132 ENSG00000154640
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q14201
Protein name Protein BTG3 (Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
Protein function Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07742 BTG 1 → 115 BTG family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO:0000269|PubMed:9067576}.
Sequence 
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENK
DENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFP
PLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDR
NHWINPHMLAPH
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  RNA degradation  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Show/Hide Text Mining Associations (39)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 26700996
Arthritis Rheumatoid Associate 18283522, 35045800
Breast Neoplasms Inhibit 18590053
Carcinogenesis Inhibit 18590053
Carcinogenesis Associate 23419616, 23533280, 23657964, 28407690
Carcinoma Hepatocellular Associate 24147003
Carcinoma Ovarian Epithelial Associate 23657964
Carcinoma Renal Cell Inhibit 19221000
Colorectal Neoplasms Associate 28407690
Colorectal Neoplasms Inhibit 29270670