BTG3 (BTG anti-proliferation factor 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10950
Gene name BTG anti-proliferation factor 3
Gene symbol BTG3
Synonyms (NCBI Gene)
ANAANA/BTG3APRO4TOB5TOB55TOFA
Chromosome 21
Chromosome location 21q21.1
Summary The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two t
miRNA miRNA information provided by mirtarbase database.
441
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (441)
miRTarBase ID miRNA Experiments Reference
MIRT019633 hsa-miR-340-5p Sequencing 20371350
MIRT020163 hsa-miR-130b-3p Sequencing 20371350
MIRT020477 hsa-miR-106b-5p Microarray 17242205
MIRT002592 hsa-miR-124-3p Microarray 18668037
MIRT002592 hsa-miR-124-3p Microarray 15685193
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
TP53 Unknown 18590053
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17690688
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 9632145
GO:0008285 Process Negative regulation of cell population proliferation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605674 1132 ENSG00000154640
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14201
Protein name Protein BTG3 (Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
Protein function Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07742 BTG 1 → 115 BTG family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO:0000269|PubMed:9067576}.
Sequence 
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENK
DENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFP
PLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDR
NHWINPHMLAPH
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  RNA degradation  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs2061607642 RCV004558029
Show/Hide Text Mining Associations (39)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 26700996
Arthritis Rheumatoid Associate 18283522, 35045800
Breast Neoplasms Inhibit 18590053
Carcinogenesis Inhibit 18590053
Carcinogenesis Associate 23419616, 23533280, 23657964, 28407690
Carcinoma Hepatocellular Associate 24147003
Carcinoma Ovarian Epithelial Associate 23657964
Carcinoma Renal Cell Inhibit 19221000
Colorectal Neoplasms Associate 28407690
Colorectal Neoplasms Inhibit 29270670