HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 10949
Gene name Heterogeneous nuclear ribonucleoprotein A0
Gene symbol HNRNPA0
Synonyms (NCBI Gene)
HNRPA0
Chromosome 5
Chromosome location 5q31.2
Summary This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs i
miRNA miRNA information provided by mirtarbase database.
862
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (862)
miRTarBase ID miRNA Experiments Reference
MIRT024198 hsa-miR-221-3p Sequencing 20371350
MIRT042915 hsa-miR-324-3p CLASH 23622248
MIRT042630 hsa-miR-423-3p CLASH 23622248
MIRT042000 hsa-miR-484 CLASH 23622248
MIRT040513 hsa-miR-548a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (24)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 7585247
GO:0003729 Function MRNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
609409 5030 ENSG00000177733
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13151
Protein name Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)
Protein function mRNA-binding component of ribonucleosomes. Specifically binds AU-rich element (ARE)-containing mRNAs. Involved in post-transcriptional regulation of cytokines mRNAs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 9 → 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 100 → 168 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence 
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE
ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQ
FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIY
SGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGG
SSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGY
GGSSF
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA