Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10941
Gene name	UDP glucuronosyltransferase family 2 member A1 complex locus
Gene symbol	UGT2A1
Synonyms (NCBI Gene)	UDPGT2A1
Chromosome	4
Chromosome location	4q13.3
Summary	The protein encoded by this gene belongs to the UDP-glycosyltransferase family, members of which catalyze biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. Th

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030180	hsa-miR-26b-5p	Microarray	19088304
MIRT526326	hsa-miR-548u	PAR-CLIP	22012620
MIRT526324	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526325	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526323	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526321	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526322	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526320	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526319	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526318	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT526326	hsa-miR-548u	PAR-CLIP	22012620
MIRT526324	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526325	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526323	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526321	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526322	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526320	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526319	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526318	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1473581	hsa-miR-125a-5p	CLIP-seq
MIRT1473582	hsa-miR-125b	CLIP-seq
MIRT1473583	hsa-miR-185	CLIP-seq
MIRT1473584	hsa-miR-214	CLIP-seq
MIRT1473585	hsa-miR-3619-5p	CLIP-seq
MIRT1473586	hsa-miR-410	CLIP-seq
MIRT1473587	hsa-miR-421	CLIP-seq
MIRT1473588	hsa-miR-4270	CLIP-seq
MIRT1473589	hsa-miR-4291	CLIP-seq
MIRT1473590	hsa-miR-4306	CLIP-seq
MIRT1473591	hsa-miR-4319	CLIP-seq
MIRT1473592	hsa-miR-4441	CLIP-seq
MIRT1473593	hsa-miR-4644	CLIP-seq
MIRT1473594	hsa-miR-4732-3p	CLIP-seq
MIRT1473595	hsa-miR-670	CLIP-seq
MIRT1473596	hsa-miR-761	CLIP-seq
MIRT1473597	hsa-miR-922	CLIP-seq
MIRT1473589	hsa-miR-4291	CLIP-seq
MIRT2462848	hsa-miR-3121-3p	CLIP-seq
MIRT2462849	hsa-miR-3123	CLIP-seq
MIRT2462850	hsa-miR-3647-3p	CLIP-seq
MIRT2462851	hsa-miR-3925-5p	CLIP-seq
MIRT2462852	hsa-miR-3927	CLIP-seq
MIRT2462853	hsa-miR-3978	CLIP-seq
MIRT2462854	hsa-miR-4261	CLIP-seq
MIRT2462855	hsa-miR-4282	CLIP-seq
MIRT2462856	hsa-miR-4451	CLIP-seq
MIRT2462857	hsa-miR-539	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19858781
GO:0007606	Process	Sensory perception of chemical stimulus	IDA	10359671
GO:0007608	Process	Sensory perception of smell	IEA
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008206	Process	Bile acid metabolic process	IDA	23756265
GO:0009608	Process	Response to symbiont	IDA	19858781
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	10359671, 19858781, 23756265
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
604716	12542	ENSG00000173610

P0DTE4

Protein name

UDP-glucuronosyltransferase 2A1 (UDPGT 2A1) (UGT2A1) (EC 2.4.1.17)

Protein function

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either th

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Olfactory epithelium, brain and fetal lung (PubMed:10359671). Not present in liver (PubMed:10359671). {ECO:0000269|PubMed:10359671}.

Sequence

MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGR
PTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFIQSSGKN
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE

Sequence length

527

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	35286894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	31001917	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgeusia	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21164388, 22984225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Olfaction Disorders	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain	Associate	29156912	★★★★★ ★☆☆☆☆ Found in Text Mining only

UGT2A1 (UDP glucuronosyltransferase family 2 member A1 complex locus)