Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10923
Gene name Gene Name - the full gene name approved by the HGNC.
SUB1 regulator of transcription
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SUB1
Synonyms (NCBI Gene) Gene synonyms aliases
P15, PC4, p14
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PC4
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019809 hsa-miR-375 Microarray 20215506
MIRT027373 hsa-miR-101-3p Sequencing 20371350
MIRT051658 hsa-let-7e-5p CLASH 23622248
MIRT614533 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT614532 hsa-miR-548ah-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IDA 8062391
GO:0003713 Function Transcription coactivator activity IBA 21873635
GO:0003713 Function Transcription coactivator activity IDA 8062391
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600503 19985 ENSG00000113387
Protein
UniProt ID P53999
Protein name Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14)
Protein function General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds s
PDB 1PCF , 2C62 , 2PHE , 4USG , 6YCS , 7E4W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02229 PC4 64 116 Transcriptional Coactivator p15 (PC4) Domain
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD
DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI
DDAVRKL
Sequence length 127
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29059683, 25751625
Unknown
Disease term Disease name Evidence References Source
Breast cancer Breast cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 28633434
Carcinoma Hepatocellular Associate 37437887, 38393314
Esophageal Squamous Cell Carcinoma Associate 25321468
Lymphoma Large B Cell Diffuse Associate 36642374
Neoplasms Associate 25321468, 26350217, 32728046, 37437887
Oculocutaneous albinism type 2 Associate 9660784