Gene Gene information from NCBI Gene database.
Entrez ID 10923
Gene name SUB1 regulator of transcription
Gene symbol SUB1
Synonyms (NCBI Gene)
P15PC4p14
Chromosome 5
Chromosome location 5p13.3
miRNA miRNA information provided by mirtarbase database.
650
miRTarBase ID miRNA Experiments Reference
MIRT019809 hsa-miR-375 Microarray 20215506
MIRT027373 hsa-miR-101-3p Sequencing 20371350
MIRT051658 hsa-let-7e-5p CLASH 23622248
MIRT614533 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT614532 hsa-miR-548ah-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0001111 Process RNA polymerase II promoter clearance IDA 25308091
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IDA 8062391
GO:0003713 Function Transcription coactivator activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600503 19985 ENSG00000113387
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P53999
Protein name Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14)
Protein function General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds s
PDB 1PCF , 2C62 , 2PHE , 4USG , 6YCS , 7E4W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02229 PC4 64 116 Transcriptional Coactivator p15 (PC4) Domain
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD
DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI
DDAVRKL
Sequence length 127
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs79931978 RCV005905114
Cholangiocarcinoma Benign rs79931978 RCV005905118
Familial cancer of breast Benign rs79931978 RCV005905113
Familial pancreatic carcinoma Benign rs79931978 RCV005905115
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 28633434
Carcinoma Hepatocellular Associate 37437887, 38393314
Esophageal Squamous Cell Carcinoma Associate 25321468
Lymphoma Large B Cell Diffuse Associate 36642374
Neoplasms Associate 25321468, 26350217, 32728046, 37437887
Oculocutaneous albinism type 2 Associate 9660784