Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10912
Gene name	Growth arrest and DNA damage inducible gamma
Gene symbol	GADD45G
Synonyms (NCBI Gene)	CR6DDIT2GADD45gammaGRP17
Chromosome	9
Chromosome location	9q22.2
Summary	This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activatio

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025170	hsa-miR-181a-5p	Microarray	17612493
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq
MIRT2232908	hsa-miR-103a	CLIP-seq
MIRT2232909	hsa-miR-107	CLIP-seq
MIRT2232910	hsa-miR-1291	CLIP-seq
MIRT2232911	hsa-miR-1343	CLIP-seq
MIRT2232912	hsa-miR-15a	CLIP-seq
MIRT2232913	hsa-miR-15b	CLIP-seq
MIRT2232914	hsa-miR-16	CLIP-seq
MIRT2232915	hsa-miR-195	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT2232916	hsa-miR-1976	CLIP-seq
MIRT2232917	hsa-miR-205	CLIP-seq
MIRT2232918	hsa-miR-3173-5p	CLIP-seq
MIRT2232919	hsa-miR-328	CLIP-seq
MIRT2232920	hsa-miR-330-3p	CLIP-seq
MIRT2232921	hsa-miR-3691-3p	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT2232922	hsa-miR-421	CLIP-seq
MIRT2232923	hsa-miR-424	CLIP-seq
MIRT2232924	hsa-miR-4282	CLIP-seq
MIRT2232925	hsa-miR-4632	CLIP-seq
MIRT2232926	hsa-miR-4685-5p	CLIP-seq
MIRT2232927	hsa-miR-4709-5p	CLIP-seq
MIRT2232928	hsa-miR-4772-3p	CLIP-seq
MIRT2232929	hsa-miR-497	CLIP-seq
MIRT2232930	hsa-miR-891b	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
CEBPB	Unknown	11012671
CEBPD	Unknown	11012671
NFKB1	Unknown	23681230
RELA	Unknown	23681230

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12052864, 12716909, 15383276, 16189514, 21900206, 21988832, 25416956, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9827804
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0006915	Process	Apoptotic process	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9827804
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	9827804
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25071184
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9827804

MIM	HGNC	e!Ensembl
604949	4097	ENSG00000130222

O95257

Protein name

Growth arrest and DNA damage-inducible protein GADD45 gamma (Cytokine-responsive protein CR6) (DNA damage-inducible transcript 2 protein) (DDIT-2)

Protein function

Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

PDB

2WAL , 3FFM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01248	Ribosomal_L7Ae	24 → 113	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Sequence length

159

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GADD45G-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	38537674	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	21568272, 23313378, 23824011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	20652500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	25912578, 36776954, 39273406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	20652500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	32138671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Associate	23512105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24763055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Communicable Diseases	Associate	35028007	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Associate	35028007	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	37657050	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	25912578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	37657050	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	37086071	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	32138671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Associate	24577085	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	36982840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	25912017	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development Group I	Associate	39273406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Inhibit	33080073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	25245461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	21568272, 23313378	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25415264, 25912017, 25912578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	38537674	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	25912578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	20739400	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia Atrioventricular Nodal Reentry	Associate	25912017	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	35137664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Associate	32138671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	34788311	★★★★★ ★☆☆☆☆ Found in Text Mining only

GADD45G (growth arrest and DNA damage inducible gamma)