ADCY3 (adenylate cyclase 3)

Gene

• Entrez ID: 109
• Gene name: Adenylate cyclase 3
• Gene symbol: ADCY3
• Synonyms (NCBI Gene): AC-III, AC3, BMIQ19
• Chromosome: 2
• Chromosome location: 2p23.3
• Summary: This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involv

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs754914420	C>-,CC	Risk-factor	Coding sequence variant, frameshift variant
rs1331776405	C>T	Risk-factor	Splice acceptor variant, intron variant
rs1553333167	C>T	Risk-factor	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022973	hsa-miR-124-3p	Microarray	18668037
MIRT037340	hsa-miR-877-5p	CLASH	23622248
MIRT036106	hsa-miR-1296-5p	CLASH	23622248
MIRT035974	hsa-miR-1301-3p	CLASH	23622248
MIRT737113	hsa-miR-423-5p	Western blotting, RNA-seq, qRT-PCR	32462942
MIRT768001	hsa-miR-1299	CLIP-seq
MIRT768002	hsa-miR-3169	CLIP-seq
MIRT768003	hsa-miR-3202	CLIP-seq
MIRT768004	hsa-miR-4533	CLIP-seq
MIRT768005	hsa-miR-4721	CLIP-seq
MIRT768006	hsa-miR-760	CLIP-seq
MIRT768007	hsa-miR-875-3p	CLIP-seq
MIRT1926511	hsa-miR-125a-3p	CLIP-seq
MIRT1926512	hsa-miR-3117-5p	CLIP-seq
MIRT1926513	hsa-miR-3144-5p	CLIP-seq
MIRT1926514	hsa-miR-3191	CLIP-seq
MIRT1926515	hsa-miR-331-3p	CLIP-seq
MIRT1926516	hsa-miR-3670	CLIP-seq
MIRT1926517	hsa-miR-4269	CLIP-seq
MIRT1926518	hsa-miR-4438	CLIP-seq
MIRT1926519	hsa-miR-4652-5p	CLIP-seq
MIRT1926520	hsa-miR-4667-5p	CLIP-seq
MIRT1926521	hsa-miR-4700-5p	CLIP-seq
MIRT1926522	hsa-miR-4722-3p	CLIP-seq
MIRT1926523	hsa-miR-4728-3p	CLIP-seq
MIRT1926524	hsa-miR-4731-5p	CLIP-seq
MIRT1926525	hsa-miR-4755-3p	CLIP-seq
MIRT1926526	hsa-miR-5095	CLIP-seq
MIRT1926527	hsa-miR-605	CLIP-seq
MIRT1926516	hsa-miR-3670	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2443190	hsa-miR-1207-5p	CLIP-seq
MIRT2443191	hsa-miR-1266	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2443192	hsa-miR-296-5p	CLIP-seq
MIRT2443193	hsa-miR-3127-5p	CLIP-seq
MIRT2443194	hsa-miR-3150b-3p	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2443195	hsa-miR-3646	CLIP-seq
MIRT2443196	hsa-miR-3659	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2443197	hsa-miR-377	CLIP-seq
MIRT2443198	hsa-miR-3918	CLIP-seq
MIRT2443199	hsa-miR-3929	CLIP-seq
MIRT2443200	hsa-miR-4263	CLIP-seq
MIRT2443201	hsa-miR-4325	CLIP-seq
MIRT2443202	hsa-miR-4419b	CLIP-seq
MIRT2443203	hsa-miR-4476	CLIP-seq
MIRT2443204	hsa-miR-4478	CLIP-seq
MIRT2443205	hsa-miR-4493	CLIP-seq
MIRT2443206	hsa-miR-4518	CLIP-seq
MIRT2443207	hsa-miR-4658	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2443208	hsa-miR-4688	CLIP-seq
MIRT2443209	hsa-miR-4689	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2443210	hsa-miR-4749-3p	CLIP-seq
MIRT2443211	hsa-miR-4763-3p	CLIP-seq
MIRT2443212	hsa-miR-4784	CLIP-seq
MIRT2443213	hsa-miR-4799-5p	CLIP-seq
MIRT2443214	hsa-miR-493	CLIP-seq
MIRT2443215	hsa-miR-574-5p	CLIP-seq
MIRT2443216	hsa-miR-576-5p	CLIP-seq
MIRT2443217	hsa-miR-648	CLIP-seq
MIRT2443218	hsa-miR-665	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq
MIRT2443194	hsa-miR-3150b-3p	CLIP-seq
MIRT2443195	hsa-miR-3646	CLIP-seq
MIRT2443196	hsa-miR-3659	CLIP-seq
MIRT2443197	hsa-miR-377	CLIP-seq
MIRT2443199	hsa-miR-3929	CLIP-seq
MIRT2443200	hsa-miR-4263	CLIP-seq
MIRT2443201	hsa-miR-4325	CLIP-seq
MIRT2443202	hsa-miR-4419b	CLIP-seq
MIRT2443203	hsa-miR-4476	CLIP-seq
MIRT2443204	hsa-miR-4478	CLIP-seq
MIRT2443205	hsa-miR-4493	CLIP-seq
MIRT2443207	hsa-miR-4658	CLIP-seq
MIRT2443209	hsa-miR-4689	CLIP-seq
MIRT2443212	hsa-miR-4784	CLIP-seq
MIRT2443213	hsa-miR-4799-5p	CLIP-seq
MIRT2443214	hsa-miR-493	CLIP-seq
MIRT2443215	hsa-miR-574-5p	CLIP-seq
MIRT2443216	hsa-miR-576-5p	CLIP-seq
MIRT2443217	hsa-miR-648	CLIP-seq
MIRT2443218	hsa-miR-665	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2443192	hsa-miR-296-5p	CLIP-seq
MIRT2443193	hsa-miR-3127-5p	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2443198	hsa-miR-3918	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004016	Function	Adenylate cyclase activity	IBA
GO:0004016	Function	Adenylate cyclase activity	IEA
GO:0004016	Function	Adenylate cyclase activity	ISS
GO:0004016	Function	Adenylate cyclase activity	TAS	9920776
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11549699
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11549699
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9920776
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0006171	Process	CAMP biosynthetic process	IBA
GO:0006171	Process	CAMP biosynthetic process	IEA
GO:0006171	Process	CAMP biosynthetic process	ISS
GO:0007165	Process	Signal transduction	TAS	9920776
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	ISS
GO:0007340	Process	Acrosome reaction	IEA
GO:0007340	Process	Acrosome reaction	ISS
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	ISS
GO:0008355	Process	Olfactory learning	IEA
GO:0008355	Process	Olfactory learning	ISS
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0060170	Component	Ciliary membrane	ISS
GO:1904322	Process	Cellular response to forskolin	IEA
GO:1904322	Process	Cellular response to forskolin	ISS

Other IDs

• MIM: 600291
• HGNC: 234
• e!Ensembl: ENSG00000138031

Protein

• UniProt ID: O60266
• Protein name: Adenylate cyclase type 3 (EC 4.6.1.1) (ATP pyrophosphate-lyase 3) (Adenylate cyclase type III) (AC-III) (Adenylate cyclase, olfactive type) (Adenylyl cyclase 3) (AC3)
• Protein function: Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. Participates in signaling cascades triggered by odorant receptors via its function in cAMP biosynthesis: specifically activated by G alpha protein GNAL/G(
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16214	AC_N	24 → 306	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
  PF00211	Guanylate_cyc	310 → 493	Adenylate and Guanylate cyclase catalytic domain	Domain
  PF00211	Guanylate_cyc	914 → 1121	Adenylate and Guanylate cyclase catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in zona glomerulosa and zona fasciculata in the adrenal gland (at protein level) (PubMed:11549699). Expressed in brain, heart, kidney, liver, lung, pancreas islets, placenta, and skeletal muscle (PubMed:9920776). Detected in t
• Sequence:

  MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
  SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDII
  LFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
  ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
  IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
  QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
  LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
  LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
  YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
  SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
  QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
  YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
  VVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
  LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
  SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
  ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
  SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
  LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
  GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
  VDNS

• Sequence length: 1144

Pathways

KEGG:

Purine metabolism
Metabolic pathways
Endocrine resistance
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Hormone signaling
Oocyte meiosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Apelin signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Thermogenesis
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
Vibrio cholerae infection
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Dilated cardiomyopathy

Reactome:

Glucagon signaling in metabolic regulation
PKA activation
PKA activation in glucagon signalling
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
G alpha (s) signalling events
G alpha (z) signalling events
Vasopressin regulates renal water homeostasis via Aquaporins
Hedgehog 'off' state
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
ADCY3-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity; risk factor	rs199731805, rs756575010, rs556248650, rs142510036, rs139420185, rs148560577, rs377506465, rs147136309, rs61729878, rs41289508, rs185180064, rs200076026, rs202180321, rs1668298380, rs532871045, rs752799012, rs1675168136, rs79661731, rs542687384, rs572878903, rs763118806, rs1012901262, rs564626097, rs147621198, rs146981649, rs917820514, rs149726253, rs757628600, rs749288972, rs762961113, rs369803323, rs779412964, rs1171056841, rs201922841, rs1377707234, rs142093233, rs1157750996, rs372828852, rs748070365, rs756783003, rs147179390, rs143034828, rs200534458, rs201606553, rs200642280, rs139407103, rs1274972048, rs769120427, rs560339786, rs751298086, rs200197892, rs772276162, rs370381628, rs752163659, rs183219559, rs150240925, rs771851785, rs373938367, rs1004125659, rs77022138, rs776111289, rs77878802, rs148445836, rs749745642, rs774738640, rs201250613, rs746964307, rs747773620, rs2466563346, rs151230629, rs758474445, rs1287549026, rs201602354, rs188231295, rs761523411, rs146622426, rs373035912, rs746309117, rs1427403684, rs2148575939, rs751871836, rs779611664, rs371984222, rs150893710, rs1049157567, rs773963140, rs752659051, rs766366885, rs139344556, rs1430218908, rs752934161, rs376158397, rs755491939, rs549867892, rs780327182, rs751105673, rs79278464, rs77454507, rs771095823, rs1290152306, rs1558410394, rs769328260, rs773378456, rs750011135, rs779982153, rs181574818, rs777304756, rs140554416, rs146260732, rs770197713, rs1328195372, rs769605240, rs746113754, rs949471026, rs763137888, rs191047121, rs1268566357, rs1275702168, rs765793242, rs146553503, rs777975260, rs144737666, rs375101795, rs144816894, rs1402883983, rs201348363, rs199524620, rs751805837, rs560091520, rs775633915, rs747444671, rs1483615736, rs1201956210, rs755247497, rs552568701, rs768438599, rs568519847, rs761801252, rs768407459, rs760176452, rs2466568158, rs77445198, rs1037666380, rs541665903, rs766627903, rs770768026, rs115329263, rs149824724, rs778587134, rs750852737, rs72792178, rs143693626, rs147964025	RCV003948797 RCV004749772 RCV003971062 RCV003978614 RCV003968702 RCV003913717 RCV003923790 RCV004750272 RCV003403909 RCV003916562 RCV003418647 RCV003961302 RCV004750230 RCV003918961 RCV003395641 RCV004750322 RCV004750327 RCV003906629 RCV003420532 RCV004750343 RCV003946476 RCV004723290 RCV003399799 RCV003420835 RCV003406187 RCV003408632 RCV003417023 RCV003417034 RCV003417088 RCV003417103 RCV003417125 RCV003417134 RCV003392791 RCV003429085 RCV003410749 RCV003402850 RCV003402166 RCV003405767 RCV003397647 RCV003405960 RCV003405970 RCV003414539 RCV003419103 RCV003394478 RCV003420748 RCV003412351 RCV003412362 RCV003429110 RCV003414201 RCV003414299 RCV003412275 RCV003402690 RCV003408744 RCV003392910 RCV003420965 RCV003966486 RCV003919257 RCV003929234 RCV003939097 RCV004750387 RCV003919294 RCV003901229 RCV003984410 RCV004750425 RCV004750445 RCV004750456 RCV003896589 RCV003898910 RCV003899054 RCV003897119 RCV003909308 RCV003909414 RCV003921516 RCV003921520 RCV003921629 RCV003921646 RCV003921929 RCV003924056 RCV003981722 RCV003983471 RCV003894073 RCV003894201 RCV003894239 RCV003894331 RCV003894432 RCV003906971 RCV003904381 RCV003904476 RCV003904617 RCV003964567 RCV003979712 RCV003901638 RCV003901686 RCV003901703 RCV003901706 RCV003899748 RCV003901917 RCV003901959 RCV003911731 RCV003903895 RCV003904048 RCV003912010 RCV003912296 RCV003907271 RCV003977267 RCV003899640 RCV003899673 RCV003911523 RCV003914047 RCV003914079 RCV003933911 RCV003934060 RCV003944044 RCV003944205 RCV003937330 RCV003964210 RCV003972000 RCV003941434 RCV003941506 RCV003941569 RCV003941606 RCV003924775 RCV003939797 RCV003934440 RCV003949775 RCV003936956 RCV003937051 RCV003947202 RCV003957107 RCV003922168 RCV003934203 RCV003934333 RCV003934342 RCV003949190 RCV003947018 RCV003934653 RCV003956672 RCV003981814 RCV003982056 RCV003947283 RCV003947317 RCV003971637 RCV003971774 RCV003969504 RCV003969604 RCV003969744 RCV003969842 RCV003961969 RCV003962165 RCV003972123 RCV004750460 RCV004750461 RCV004748831 RCV003970770 RCV003913297 RCV003978054
BODY MASS INDEX QUANTITATIVE TRAIT LOCUS 19	Uncertain significance; risk factor	rs750100320, rs1468632399, rs1389987930, rs1331776405, rs1553329804, rs754914420, rs1553333167, rs750852737	RCV003142323 RCV003142432 RCV003142451 RCV000585736 RCV000585664 RCV000585693 RCV000585729 RCV000585672
Melanoma	Likely benign	rs139420185	RCV005925759
Sarcoma	Likely benign	rs139420185	RCV005925756
Thymoma	Likely benign	rs139420185	RCV005925757
Thyroid cancer, nonmedullary, 1	Likely benign	rs139420185	RCV005925758

Associations from Text Mining
Disease Name	Relationship Type	References
Asthma	Associate	34727921
Carcinoma Renal Cell	Associate	29748622
Cardiovascular Diseases	Associate	24243566
Carotid Stenosis	Associate	32037372
Chronic Traumatic Encephalopathy	Associate	29338612
Cysts	Associate	22952279
Diabetes Mellitus	Associate	27322064
Diabetes Mellitus Type 2	Associate	27322064, 29311636
Dyslipidemias	Associate	32698306
Fibrous Dysplasia Polyostotic	Associate	26651848
Genetic Diseases Inborn	Associate	32699307
Hypertension	Associate	32698306
Inflammatory Bowel Diseases	Associate	25766683
Insulin Resistance	Associate	39519366
Leukemia Lymphoma Adult T Cell	Associate	37832654
Melanoma Cutaneous Malignant	Associate	32699307
Neoplasms	Associate	24243566
Non alcoholic Fatty Liver Disease	Associate	32698306
Obesity	Associate	21079816, 21840420, 26449484, 27322064, 29311636, 29921800, 32153512, 34207686, 34821371, 35026759, 36775011, 36839421, 37000968, 37329217, 39519366, 39766774
Overweight	Associate	39766774
Pigmentation Disorders	Associate	32699307
Polycystic Kidney Autosomal Dominant	Associate	22952279
Stomach Neoplasms	Associate	30106120, 35036435
Weight Loss	Associate	29921800