Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10897
Gene name Gene Name - the full gene name approved by the HGNC.	Yip1 interacting factor homolog A, membrane trafficking protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	YIF1A
Synonyms (NCBI Gene) Gene synonyms aliases	54TM, FinGER7, YIF1, YIF1P
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029351	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22645275, 23736259, 26496610, 26638075, 28298427, 32296183, 32814053
GO:0005789	Component	Endoplasmic reticulum membrane	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IBA	21873635
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	15308636
GO:0005794	Component	Golgi apparatus	IDA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	21873635
GO:0015031	Process	Protein transport	IEA
GO:0030134	Component	COPII-coated ER to Golgi transport vesicle	IBA	21873635
GO:0030173	Component	Integral component of Golgi membrane	IBA	21873635
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0036498	Process	IRE1-mediated unfolded protein response	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA

MIM	HGNC	e!Ensembl
611484	16688	ENSG00000174851

Protein

UniProt ID

O95070

Protein name

Protein YIF1A (54TMp) (YIP1-interacting factor homolog A)

Protein function

Possible role in transport between endoplasmic reticulum and Golgi.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03878	YIF1	56 → 288	YIF1	Family

Sequence

MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMA
NVAMAYGSSIASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEV
QYSRDAPLPPRQDLNAPDLYIPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVV
MEVLALLLGLYLATVRSDLSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA
LMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR

Sequence length

293

Interactions

View interactions

	Reactome
			XBP1(S) activates chaperone genes

YIF1A (Yip1 interacting factor homolog A, membrane trafficking protein)