Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10893
Gene name	Matrix metallopeptidase 24
Gene symbol	MMP24
Synonyms (NCBI Gene)	MMP-24MMP25MT-MMP 5MT-MMP5MT5-MMPMT5MMPMTMMP5
Chromosome	20
Chromosome location	20q11.22
Summary	This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and t

177

Show/Hide all (177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005385	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	21305051
MIRT005386	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCR	21305051
MIRT005385	hsa-miR-29b-3p	Microarray	22942087
MIRT1153373	hsa-miR-106a	CLIP-seq
MIRT1153374	hsa-miR-106b	CLIP-seq
MIRT1153375	hsa-miR-1225-3p	CLIP-seq
MIRT1153376	hsa-miR-1260	CLIP-seq
MIRT1153377	hsa-miR-1260b	CLIP-seq
MIRT1153378	hsa-miR-1273e	CLIP-seq
MIRT1153379	hsa-miR-1287	CLIP-seq
MIRT1153380	hsa-miR-134	CLIP-seq
MIRT1153381	hsa-miR-142-5p	CLIP-seq
MIRT1153382	hsa-miR-17	CLIP-seq
MIRT1153383	hsa-miR-188-3p	CLIP-seq
MIRT1153384	hsa-miR-1976	CLIP-seq
MIRT1153385	hsa-miR-203	CLIP-seq
MIRT1153386	hsa-miR-20a	CLIP-seq
MIRT1153387	hsa-miR-20b	CLIP-seq
MIRT1153388	hsa-miR-2276	CLIP-seq
MIRT1153389	hsa-miR-29a	CLIP-seq
MIRT1153390	hsa-miR-29b	CLIP-seq
MIRT1153391	hsa-miR-29c	CLIP-seq
MIRT1153392	hsa-miR-3117-5p	CLIP-seq
MIRT1153393	hsa-miR-3118	CLIP-seq
MIRT1153394	hsa-miR-3127-3p	CLIP-seq
MIRT1153395	hsa-miR-3135b	CLIP-seq
MIRT1153396	hsa-miR-3136-5p	CLIP-seq
MIRT1153397	hsa-miR-3138	CLIP-seq
MIRT1153398	hsa-miR-3156-3p	CLIP-seq
MIRT1153399	hsa-miR-3158-3p	CLIP-seq
MIRT1153400	hsa-miR-3164	CLIP-seq
MIRT1153401	hsa-miR-3176	CLIP-seq
MIRT1153402	hsa-miR-3179	CLIP-seq
MIRT1153403	hsa-miR-320a	CLIP-seq
MIRT1153404	hsa-miR-320b	CLIP-seq
MIRT1153405	hsa-miR-320c	CLIP-seq
MIRT1153406	hsa-miR-320d	CLIP-seq
MIRT1153407	hsa-miR-320e	CLIP-seq
MIRT1153408	hsa-miR-3609	CLIP-seq
MIRT1153409	hsa-miR-3613-3p	CLIP-seq
MIRT1153410	hsa-miR-3662	CLIP-seq
MIRT1153411	hsa-miR-3663-3p	CLIP-seq
MIRT1153412	hsa-miR-3672	CLIP-seq
MIRT1153413	hsa-miR-370	CLIP-seq
MIRT1153414	hsa-miR-3914	CLIP-seq
MIRT1153415	hsa-miR-3922-3p	CLIP-seq
MIRT1153416	hsa-miR-3934	CLIP-seq
MIRT1153417	hsa-miR-3974	CLIP-seq
MIRT1153418	hsa-miR-4268	CLIP-seq
MIRT1153419	hsa-miR-4276	CLIP-seq
MIRT1153420	hsa-miR-4281	CLIP-seq
MIRT1153421	hsa-miR-4429	CLIP-seq
MIRT1153422	hsa-miR-4439	CLIP-seq
MIRT1153423	hsa-miR-4446-3p	CLIP-seq
MIRT1153424	hsa-miR-4463	CLIP-seq
MIRT1153425	hsa-miR-4473	CLIP-seq
MIRT1153426	hsa-miR-4494	CLIP-seq
MIRT1153427	hsa-miR-4501	CLIP-seq
MIRT1153428	hsa-miR-4504	CLIP-seq
MIRT1153429	hsa-miR-4513	CLIP-seq
MIRT1153430	hsa-miR-4520a-3p	CLIP-seq
MIRT1153431	hsa-miR-4640-5p	CLIP-seq
MIRT1153432	hsa-miR-4645-5p	CLIP-seq
MIRT1153433	hsa-miR-4671-5p	CLIP-seq
MIRT1153434	hsa-miR-4673	CLIP-seq
MIRT1153435	hsa-miR-4704-3p	CLIP-seq
MIRT1153436	hsa-miR-4726-5p	CLIP-seq
MIRT1153437	hsa-miR-4757-5p	CLIP-seq
MIRT1153438	hsa-miR-4796-3p	CLIP-seq
MIRT1153439	hsa-miR-493	CLIP-seq
MIRT1153440	hsa-miR-498	CLIP-seq
MIRT1153441	hsa-miR-512-3p	CLIP-seq
MIRT1153442	hsa-miR-519d	CLIP-seq
MIRT1153443	hsa-miR-520f	CLIP-seq
MIRT1153444	hsa-miR-542-3p	CLIP-seq
MIRT1153445	hsa-miR-548ah	CLIP-seq
MIRT1153446	hsa-miR-552	CLIP-seq
MIRT1153447	hsa-miR-610	CLIP-seq
MIRT1153448	hsa-miR-93	CLIP-seq
MIRT1153388	hsa-miR-2276	CLIP-seq
MIRT1153424	hsa-miR-4463	CLIP-seq
MIRT1153426	hsa-miR-4494	CLIP-seq
MIRT1153432	hsa-miR-4645-5p	CLIP-seq
MIRT1153434	hsa-miR-4673	CLIP-seq
MIRT1153444	hsa-miR-542-3p	CLIP-seq
MIRT2043918	hsa-miR-1913	CLIP-seq
MIRT2043919	hsa-miR-3173-5p	CLIP-seq
MIRT2043920	hsa-miR-324-3p	CLIP-seq
MIRT2043921	hsa-miR-326	CLIP-seq
MIRT2043922	hsa-miR-330-5p	CLIP-seq
MIRT2043923	hsa-miR-4749-3p	CLIP-seq
MIRT2043924	hsa-miR-760	CLIP-seq
MIRT2273310	hsa-miR-1256	CLIP-seq
MIRT2273311	hsa-miR-3121-5p	CLIP-seq
MIRT2273312	hsa-miR-3134	CLIP-seq
MIRT2043921	hsa-miR-326	CLIP-seq
MIRT2043922	hsa-miR-330-5p	CLIP-seq
MIRT2273313	hsa-miR-342-5p	CLIP-seq
MIRT2273314	hsa-miR-3929	CLIP-seq
MIRT2273315	hsa-miR-3945	CLIP-seq
MIRT2273316	hsa-miR-4253	CLIP-seq
MIRT2273317	hsa-miR-4419b	CLIP-seq
MIRT2273318	hsa-miR-4478	CLIP-seq
MIRT2273319	hsa-miR-4534	CLIP-seq
MIRT2273320	hsa-miR-4651	CLIP-seq
MIRT2273321	hsa-miR-4664-5p	CLIP-seq
MIRT1153444	hsa-miR-542-3p	CLIP-seq
MIRT2273322	hsa-miR-608	CLIP-seq
MIRT2273323	hsa-miR-615-5p	CLIP-seq
MIRT1153380	hsa-miR-134	CLIP-seq
MIRT1153385	hsa-miR-203	CLIP-seq
MIRT1153392	hsa-miR-3117-5p	CLIP-seq
MIRT1153393	hsa-miR-3118	CLIP-seq
MIRT1153396	hsa-miR-3136-5p	CLIP-seq
MIRT1153400	hsa-miR-3164	CLIP-seq
MIRT1153410	hsa-miR-3662	CLIP-seq
MIRT2390981	hsa-miR-4271	CLIP-seq
MIRT1153422	hsa-miR-4439	CLIP-seq
MIRT1153427	hsa-miR-4501	CLIP-seq
MIRT1153429	hsa-miR-4513	CLIP-seq
MIRT2390982	hsa-miR-4725-3p	CLIP-seq
MIRT2454304	hsa-miR-1291	CLIP-seq
MIRT1153385	hsa-miR-203	CLIP-seq
MIRT2454305	hsa-miR-2278	CLIP-seq
MIRT2454306	hsa-miR-2964a-5p	CLIP-seq
MIRT2454307	hsa-miR-296-5p	CLIP-seq
MIRT1153392	hsa-miR-3117-5p	CLIP-seq
MIRT1153397	hsa-miR-3138	CLIP-seq
MIRT2454308	hsa-miR-3607-5p	CLIP-seq
MIRT2454309	hsa-miR-361-3p	CLIP-seq
MIRT1153416	hsa-miR-3934	CLIP-seq
MIRT2454310	hsa-miR-4302	CLIP-seq
MIRT2454311	hsa-miR-4426	CLIP-seq
MIRT2454312	hsa-miR-4481	CLIP-seq
MIRT2454313	hsa-miR-4519	CLIP-seq
MIRT1153430	hsa-miR-4520a-3p	CLIP-seq
MIRT2454314	hsa-miR-4647	CLIP-seq
MIRT2454315	hsa-miR-4648	CLIP-seq
MIRT2454316	hsa-miR-4654	CLIP-seq
MIRT2454317	hsa-miR-4662b	CLIP-seq
MIRT2454318	hsa-miR-4679	CLIP-seq
MIRT2454319	hsa-miR-4745-5p	CLIP-seq
MIRT2454320	hsa-miR-4747-5p	CLIP-seq
MIRT2454321	hsa-miR-4758-5p	CLIP-seq
MIRT2454322	hsa-miR-4769-5p	CLIP-seq
MIRT1153446	hsa-miR-552	CLIP-seq
MIRT1153447	hsa-miR-610	CLIP-seq
MIRT2454304	hsa-miR-1291	CLIP-seq
MIRT2043919	hsa-miR-3173-5p	CLIP-seq
MIRT2465642	hsa-miR-328	CLIP-seq
MIRT1153411	hsa-miR-3663-3p	CLIP-seq
MIRT1153413	hsa-miR-370	CLIP-seq
MIRT2465643	hsa-miR-4299	CLIP-seq
MIRT2465644	hsa-miR-4710	CLIP-seq
MIRT2465645	hsa-miR-4792	CLIP-seq
MIRT2572207	hsa-miR-1244	CLIP-seq
MIRT2454304	hsa-miR-1291	CLIP-seq
MIRT2043919	hsa-miR-3173-5p	CLIP-seq
MIRT2465642	hsa-miR-328	CLIP-seq
MIRT1153411	hsa-miR-3663-3p	CLIP-seq
MIRT1153413	hsa-miR-370	CLIP-seq
MIRT2465643	hsa-miR-4299	CLIP-seq
MIRT2572208	hsa-miR-4436a	CLIP-seq
MIRT2465644	hsa-miR-4710	CLIP-seq
MIRT2465645	hsa-miR-4792	CLIP-seq
MIRT2572207	hsa-miR-1244	CLIP-seq
MIRT2454304	hsa-miR-1291	CLIP-seq
MIRT2685153	hsa-miR-193a-3p	CLIP-seq
MIRT2685154	hsa-miR-193b	CLIP-seq
MIRT2043919	hsa-miR-3173-5p	CLIP-seq
MIRT2465642	hsa-miR-328	CLIP-seq
MIRT1153411	hsa-miR-3663-3p	CLIP-seq
MIRT1153413	hsa-miR-370	CLIP-seq
MIRT2465643	hsa-miR-4299	CLIP-seq
MIRT2572208	hsa-miR-4436a	CLIP-seq
MIRT2465644	hsa-miR-4710	CLIP-seq
MIRT2465645	hsa-miR-4792	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	ISS
GO:0004222	Function	Metalloendopeptidase activity	TAS	10363975
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	10363975
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	ISS
GO:0006508	Process	Proteolysis	TAS	10363975
GO:0007155	Process	Cell adhesion	IEA
GO:0008047	Function	Enzyme activator activity	TAS	10363975
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010001	Process	Glial cell differentiation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0032588	Component	Trans-Golgi network membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IEA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	ISS
GO:0045296	Function	Cadherin binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	ISS
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IEA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	ISS

MIM	HGNC	e!Ensembl
604871	7172	ENSG00000125966

Q9Y5R2

Protein name

Matrix metalloproteinase-24 (MMP-24) (EC 3.4.24.-) (Membrane-type matrix metalloproteinase 5) (MT-MMP 5) (MTMMP5) (Membrane-type-5 matrix metalloproteinase) (MT5-MMP) (MT5MMP) [Cleaved into: Processed matrix metalloproteinase-24]

Protein function

Metalloprotease that mediates cleavage of N-cadherin (CDH2) and acts as a regulator of neuro-immune interactions and neural stem cell quiescence. Involved in cell-cell interactions between nociceptive neurites and mast cells, possibly by mediati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	76 → 134	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	162 → 327	Matrixin	Domain
PF00045	Hemopexin	384 → 427	Hemopexin	Repeat
PF00045	Hemopexin	429 → 472	Hemopexin	Repeat
PF00045	Hemopexin	476 → 522	Hemopexin	Repeat
PF00045	Hemopexin	524 → 569	Hemopexin	Repeat
PF11857	DUF3377	575 → 645	Domain of unknown function (DUF3377)	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in brain, kidney, pancreas and lung. Overexpressed in a series of brain tumors, including astrocytomas and glioblastomas. {ECO:0000269|PubMed:10363975}.

Sequence

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV

Sequence length

645

Interactions

View interactions

	KEGG		Reactome
	Parathyroid hormone synthesis, secretion and action		Activation of Matrix Metalloproteinases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acidosis Renal Tubular	Associate	11457723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	33892965, 34359875	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Associate	11457723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19531263, 35177031	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	23568046	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35062057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	11457723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Inhibit	39273639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	17952761	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	35018451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	11457723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	34166375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	32043788	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35177031	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35062057, 35177031	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurotoxicity Syndromes	Stimulate	34359875	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Diseases	Stimulate	17952761	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	15928670, 32669958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Associate	11457723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Associate	35018451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	22677901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	24669030	★★★★★ ★☆☆☆☆ Found in Text Mining only

MMP24 (matrix metallopeptidase 24)