Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10892
Gene name Gene Name - the full gene name approved by the HGNC.
MALT1 paracaspase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MALT1
Synonyms (NCBI Gene) Gene synonyms aliases
IMD12, MLT, MLT1, PCASP1
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a caspase-like protease that plays a role in BCL10-induced activation of NF-kappaB. The protein is a component of the CARMA1-BCL10-MALT1 (CBM) signalosome that triggers NF-kappaB signaling and lymphoctye activation following antigen-rece
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777337 G>C Pathogenic Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant
rs786200953 A>G Pathogenic Splice acceptor variant
rs786200954 C>- Pathogenic Non coding transcript variant, frameshift variant, coding sequence variant
rs1266114717 C>G,T Pathogenic, likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant, stop gained
rs1602300615 ->C Pathogenic Coding sequence variant, frameshift variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030793 hsa-miR-21-5p Microarray 18591254
MIRT529444 hsa-miR-409-3p PAR-CLIP 22012620
MIRT529443 hsa-miR-33a-3p PAR-CLIP 22012620
MIRT529442 hsa-miR-590-3p PAR-CLIP 22012620
MIRT529441 hsa-miR-512-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0001923 Process B-1 B cell differentiation IEA
GO:0002020 Function Protease binding IEA
GO:0002096 Component Polkadots IEA
GO:0002376 Process Immune system process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604860 6819 ENSG00000172175
Protein
UniProt ID Q9UDY8
Protein name Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (EC 3.4.22.-) (MALT lymphoma-associated translocation) (Paracaspase)
Protein function Protease that enhances BCL10-induced activation: acts via formation of CBM complexes that channel adaptive and innate immune signaling downstream of CARD domain-containing proteins (CARD9, CARD11 and CARD14) to activate NF-kappa-B and MAP kinase
PDB 2G7R , 3BFO , 3K0W , 3UO8 , 3UOA , 3V4O , 3V55 , 4I1P , 4I1R , 6F7I , 6GK2 , 6H4A , 6YN8 , 6YN9 , 7A41 , 7AK0 , 7AK1 , 7PAV , 7PAW , 8CZO , 8J5I , 8V4X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 124 194 Domain
PF13895 Ig_2 226 308 Immunoglobulin domain Domain
PF00656 Peptidase_C14 343 560 Domain
PF18703 MALT1_Ig 583 719 MALT1 Ig-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in peripheral blood mononuclear cells. Detected at lower levels in bone marrow, thymus and lymph node, and at very low levels in colon and lung.
Sequence
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNN
NFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIII
GRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRAL
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHR
G
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
Sequence length 824
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
C-type lectin receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Shigellosis
Tuberculosis
  Activation of NF-kappaB in B cells
Downstream TCR signaling
FCERI mediated NF-kB activation
CLEC7A (Dectin-1) signaling
CLEC7A/inflammasome pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Immunodeficiency combined immunodeficiency due to malt1 deficiency rs398123058, rs587777337, rs786200953, rs1266114717, rs1602300615 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Neuroblastoma Neuroblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36357817
Adenocarcinoma of Lung Associate 27025651
Adenoma Islet Cell Associate 19060847
Aortic Dissection Associate 37704417
Arthritis Rheumatoid Inhibit 24971370
Arthritis Rheumatoid Associate 34788483
Arthritis Rheumatoid Stimulate 35967391
Asthma Stimulate 35353938
Autoimmune Diseases Associate 34788483
Cap Myopathy Associate 32665124