Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10875
Gene name Gene Name - the full gene name approved by the HGNC.	Fibrinogen like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGL2
Synonyms (NCBI Gene) Gene synonyms aliases	T49, pT49
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric comp

Show/Hide all(122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018781	hsa-miR-335-5p	Microarray	18185580
MIRT030088	hsa-miR-26b-5p	Microarray	19088304
MIRT440643	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440643	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT996284	hsa-miR-1267	CLIP-seq
MIRT996285	hsa-miR-132	CLIP-seq
MIRT996286	hsa-miR-212	CLIP-seq
MIRT996287	hsa-miR-296-3p	CLIP-seq
MIRT996288	hsa-miR-30a	CLIP-seq
MIRT996289	hsa-miR-30b	CLIP-seq
MIRT996290	hsa-miR-30c	CLIP-seq
MIRT996291	hsa-miR-30d	CLIP-seq
MIRT996292	hsa-miR-30e	CLIP-seq
MIRT996293	hsa-miR-3120-3p	CLIP-seq
MIRT996294	hsa-miR-3143	CLIP-seq
MIRT996295	hsa-miR-33a	CLIP-seq
MIRT996296	hsa-miR-33b	CLIP-seq
MIRT996297	hsa-miR-3973	CLIP-seq
MIRT996298	hsa-miR-409-3p	CLIP-seq
MIRT996299	hsa-miR-4273	CLIP-seq
MIRT996300	hsa-miR-4652-3p	CLIP-seq
MIRT996301	hsa-miR-4677-5p	CLIP-seq
MIRT996302	hsa-miR-4684-3p	CLIP-seq
MIRT996303	hsa-miR-4699-3p	CLIP-seq
MIRT996304	hsa-miR-4753-3p	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT996306	hsa-miR-513a-5p	CLIP-seq
MIRT996307	hsa-miR-518a-5p	CLIP-seq
MIRT996308	hsa-miR-527	CLIP-seq
MIRT996309	hsa-miR-543	CLIP-seq
MIRT996310	hsa-miR-548a-5p	CLIP-seq
MIRT996311	hsa-miR-548ab	CLIP-seq
MIRT996312	hsa-miR-548ak	CLIP-seq
MIRT996313	hsa-miR-548b-5p	CLIP-seq
MIRT996314	hsa-miR-548c-5p	CLIP-seq
MIRT996315	hsa-miR-548d-5p	CLIP-seq
MIRT996316	hsa-miR-548h	CLIP-seq
MIRT996317	hsa-miR-548i	CLIP-seq
MIRT996318	hsa-miR-548j	CLIP-seq
MIRT996319	hsa-miR-548w	CLIP-seq
MIRT996320	hsa-miR-548y	CLIP-seq
MIRT996321	hsa-miR-559	CLIP-seq
MIRT996322	hsa-miR-619	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995383	hsa-miR-150	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995386	hsa-miR-3159	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995389	hsa-miR-4328	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT1995393	hsa-miR-562	CLIP-seq
MIRT1995394	hsa-miR-576-3p	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT1995396	hsa-miR-944	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT2229453	hsa-miR-1236	CLIP-seq
MIRT2229454	hsa-miR-1305	CLIP-seq
MIRT1995383	hsa-miR-150	CLIP-seq
MIRT2229455	hsa-miR-1976	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT1995386	hsa-miR-3159	CLIP-seq
MIRT2229456	hsa-miR-3187-3p	CLIP-seq
MIRT2229457	hsa-miR-3617	CLIP-seq
MIRT2229458	hsa-miR-3663-5p	CLIP-seq
MIRT2229459	hsa-miR-371-5p	CLIP-seq
MIRT2229460	hsa-miR-371b-5p	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT2229461	hsa-miR-4279	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995389	hsa-miR-4328	CLIP-seq
MIRT2229462	hsa-miR-4435	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT2229463	hsa-miR-4701-5p	CLIP-seq
MIRT2229464	hsa-miR-4722-3p	CLIP-seq
MIRT2229465	hsa-miR-4755-3p	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT2229466	hsa-miR-494	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2229467	hsa-miR-548s	CLIP-seq
MIRT1995393	hsa-miR-562	CLIP-seq
MIRT2229468	hsa-miR-588	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT2229469	hsa-miR-641	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2428937	hsa-miR-3144-3p	CLIP-seq
MIRT2428938	hsa-miR-556-5p	CLIP-seq
MIRT2428939	hsa-miR-875-5p	CLIP-seq
MIRT2428937	hsa-miR-3144-3p	CLIP-seq
MIRT2428938	hsa-miR-556-5p	CLIP-seq
MIRT2428939	hsa-miR-875-5p	CLIP-seq
MIRT2449685	hsa-miR-4735-5p	CLIP-seq
MIRT2449686	hsa-miR-4775	CLIP-seq
MIRT2449687	hsa-miR-590-3p	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT2533356	hsa-miR-3065-5p	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT2449685	hsa-miR-4735-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT2449686	hsa-miR-4775	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2449687	hsa-miR-590-3p	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT2533356	hsa-miR-3065-5p	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP1	Unknown	11170750

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	IEA
GO:0002617	Process	Negative regulation of macrophage antigen processing and presentation	IEA
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28327460
GO:0005576	Component	Extracellular region	TAS
GO:0005577	Component	Fibrinogen complex	TAS	7642106
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043381	Process	Negative regulation of memory T cell differentiation	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	28327460
GO:0062023	Component	Collagen-containing extracellular matrix	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
605351	3696	ENSG00000127951

Protein

UniProt ID

Q14314

Protein name

Fibroleukin (Fibrinogen-like protein 2) (pT49)

Protein function

May play a role in physiologic lymphocyte functions at mucosal sites.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	209 → 435	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Constitutively expressed in cytotoxic T-cells.

Sequence

MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVS
LPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTG
APGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANL
TFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEV
YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPD
KDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
YKSSFKEAKMMIRPKHFKP

Sequence length

439

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17374397

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Disease	Associate	36755239
Acute On Chronic Liver Failure	Associate	23067542
Aortic Dissection	Associate	36755239
Breast Neoplasms	Inhibit	32716910
Carcinoma Hepatocellular	Associate	18715028
Carcinoma Non Small Cell Lung	Associate	36969247
Carcinoma Renal Cell	Stimulate	28978925
Colitis Ulcerative	Stimulate	24287641
Colorectal Neoplasms	Associate	25129313, 38036953
Communicable Diseases	Associate	38310908
COVID 19	Associate	32344305
Crohn Disease	Stimulate	24287641
Esophageal Neoplasms	Associate	33323552
Gastrointestinal Stromal Tumors	Associate	35029030
Glioma	Stimulate	32716910
Hypothyroidism Congenital Nongoitrous 2	Associate	33893391
Inflammation	Associate	32713274, 36755239
Inflammatory Bowel Diseases	Associate	24287641
Lymphoma	Associate	25303152
Lymphoma B Cell	Associate	25303152
Meningioma	Associate	32596316
Necrosis	Associate	19423547
Neoplasm Metastasis	Associate	25129313
Neoplasms	Stimulate	25129313
Neoplasms	Associate	25303152, 28978925, 32716910, 33323552
Neoplasms	Inhibit	36969247
Obesity	Associate	32188105
Placenta Diseases	Associate	32713274
Pre Eclampsia	Associate	32713274
Respiratory Distress Syndrome	Associate	34393665
Sepsis	Associate	34393665
Thrombosis	Associate	19423547
Urticaria	Associate	31653482
Vascular Diseases	Associate	32713274

FGL2 (fibrinogen like 2)