NMU (neuromedin U)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10874
Gene name Neuromedin U
Gene symbol NMU
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q12
Summary This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory disea
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT024550 hsa-miR-215-5p Microarray 19074876
MIRT026774 hsa-miR-192-5p Microarray 19074876
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
MYB Unknown 15187020
VHL Repression 21791076
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (40)
GO ID Ontology Definition Evidence Reference
GO:0001659 Process Temperature homeostasis IEA
GO:0001696 Process Gastric acid secretion IEA
GO:0003084 Process Positive regulation of systemic arterial blood pressure IEA
GO:0005102 Function Signaling receptor binding TAS 10811630
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605103 7859 ENSG00000109255
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P48645
Protein name Neuromedin-U [Cleaved into: Neuromedin precursor-related peptide 36 (NURP36); Neuromedin precursor-related peptide 33 (NURP33); Neuromedin-U-25 (NmU-25)]
Protein function [Neuromedin-U-25]: Ligand for receptors NMUR1 and NMUR2 (By similarity). Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder. {ECO:0000250|UniP
PDB 7W53 , 7W55 , 7XK8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02070 NMU 142 → 166 Neuromedin U Family
Tissue specificity TISSUE SPECIFICITY: Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
Sequence 
MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDD
TCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVV
SSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Sequence length 174
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neuroactive ligand-receptor interaction   Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OBESITY — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (33)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 32384511, 34336003
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Associate 36776063
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Associate 32460303
★★★★★
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Associate 29940585, 36042613
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 28423716
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 26317338
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 32013887
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Associate 27669169, 33505535
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 31144675, 32351322, 34493299, 36482448
★★★★★
★☆☆☆☆
Found in Text Mining only
Dementia Vascular Associate 36776063
★★★★★
★☆☆☆☆
Found in Text Mining only