Gene Gene information from NCBI Gene database.
Entrez ID 10866
Gene name HLA complex P5
Gene symbol HCP5
Synonyms (NCBI Gene)
6S2650ED6S2650EP5-1
Chromosome 6
Chromosome location 6p21.33
miRNA miRNA information provided by mirtarbase database.
465
miRTarBase ID miRNA Experiments Reference
MIRT440522 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440520 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT440522 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT727516 hsa-miR-17-5p HITS-CLIP 22473208
MIRT727517 hsa-miR-20b-5p HITS-CLIP 22473208
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604676 21659 ENSG00000206337
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6MZN7
Protein name HLA class I histocompatibility antigen protein P5 (HLA complex protein P5) (Protein P5-1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in lymphoid tissues; Detected in spleen as well as in B-cell lines, NK cell lines and activated lymphocytes. {ECO:0000269|PubMed:8462994}.
Sequence
MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQG
DPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSM
GTHLSPFKGTLL
Sequence length 132
Interactions View interactions