Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10866
Gene name Gene Name - the full gene name approved by the HGNC.
HLA complex P5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HCP5
Synonyms (NCBI Gene) Gene synonyms aliases
6S2650E, D6S2650E, P5-1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT440522 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440520 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT440522 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT727516 hsa-miR-17-5p HITS-CLIP 22473208
MIRT727517 hsa-miR-20b-5p HITS-CLIP 22473208
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604676 21659 ENSG00000206337
Protein
UniProt ID Q6MZN7
Protein name HLA class I histocompatibility antigen protein P5 (HLA complex protein P5) (Protein P5-1)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in lymphoid tissues; Detected in spleen as well as in B-cell lines, NK cell lines and activated lymphocytes. {ECO:0000269|PubMed:8462994}.
Sequence
MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQG
DPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSM
GTHLSPFKGTLL
Sequence length 132
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Adult asthma, Atopic asthma, Asthma N/A N/A GWAS
Carpal Tunnel Syndrome Carpal tunnel syndrome N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 35648061
Acquired Immunodeficiency Syndrome Associate 20704485, 21107268
Adenocarcinoma Follicular Associate 31102936
Adenocarcinoma of Lung Inhibit 28793054
Arthritis Psoriatic Associate 18369459
Arthritis Rheumatoid Associate 18369459
Autism Spectrum Disorder Associate 38287090
Autistic Disorder Associate 38287090
Autoimmune Diseases Associate 18369459, 36958849
Carcinoma Hepatocellular Associate 34148029