ARID5A (AT-rich interaction domain 5A)

Gene

• Entrez ID: 10865
• Gene name: AT-rich interaction domain 5A
• Gene symbol: ARID5A
• Synonyms (NCBI Gene): MRF-1, MRF1, RP11-363D14
• Chromosome: 2
• Chromosome location: 2q11.2
• Summary: Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043168	hsa-miR-324-5p	CLASH	23622248
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT1935294	hsa-miR-1343	CLIP-seq
MIRT1935295	hsa-miR-3132	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT1935296	hsa-miR-4269	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT1935297	hsa-miR-4690-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15941852
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0003677	Function	DNA binding	TAS	15640446
GO:0003714	Function	Transcription corepressor activity	IDA	15941852
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15941852, 16713569, 23275563, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008134	Function	Transcription factor binding	IDA	15941852
GO:0030331	Function	Estrogen receptor binding	IDA	15941852
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043565	Function	Sequence-specific DNA binding	IDA	15640446
GO:0045087	Process	Innate immune response	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	TAS	15640446
GO:0046965	Function	Retinoid X receptor binding	IDA	15941852
GO:0046966	Function	Thyroid hormone receptor binding	IDA	15941852
GO:0050681	Function	Androgen receptor binding	IDA	15941852
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	15941852

Other IDs

• MIM: 611583
• HGNC: 17361
• e!Ensembl: ENSG00000196843

Protein

• UniProt ID: Q03989
• Protein name: AT-rich interactive domain-containing protein 5A (ARID domain-containing protein 5A) (Modulator recognition factor 1) (MRF-1)
• Protein function: DNA-binding protein that may regulate transcription and act as a repressor by binding to AT-rich stretches in the promoter region of target genes (PubMed:8649988). May positively regulate chondrocyte-specific transcription such as of COL2A1 in c
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01388	ARID	57 → 142	ARID/BRIGHT DNA binding domain	Domain

• Sequence:

  MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQA
  FLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGG
  SPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPK
  KAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYK
  RLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQS
  PKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPR
  DFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP
  MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAG
  SGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLA
  TAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL

• Sequence length: 594

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Unknown
Disease term	Disease name	Evidence	References	Source
Hypothyroidism	Hypothyroidism			GWAS
Sarcoidosis	Sarcoidosis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Autoimmune Diseases	Associate	37129704
Breast Neoplasms	Associate	33592583
Inflammation	Associate	37129704
Influenza Human	Associate	35893690
Lung Neoplasms	Associate	32548260
Neoplasms	Associate	32548260
Prostatic Neoplasms	Associate	34633095