Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10861
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 26 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC26A1
Synonyms (NCBI Gene) Gene synonyms aliases	CAON, CAON1, EDM4, HYSULF, SAT-1, SAT1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. T

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments
MIRT2624434	hsa-miR-1184	CLIP-seq
MIRT2624435	hsa-miR-1205	CLIP-seq
MIRT2624436	hsa-miR-3158-5p	CLIP-seq
MIRT2624437	hsa-miR-4279	CLIP-seq
MIRT2624438	hsa-miR-4435	CLIP-seq
MIRT2624439	hsa-miR-4768-5p	CLIP-seq
MIRT2624440	hsa-miR-942	CLIP-seq
MIRT2624434	hsa-miR-1184	CLIP-seq
MIRT2624435	hsa-miR-1205	CLIP-seq
MIRT2624436	hsa-miR-3158-5p	CLIP-seq
MIRT2624437	hsa-miR-4279	CLIP-seq
MIRT2624438	hsa-miR-4435	CLIP-seq
MIRT2624439	hsa-miR-4768-5p	CLIP-seq
MIRT2624440	hsa-miR-942	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	12713736, 27125215
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0006821	Process	Chloride transport	ISS
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA
GO:0015116	Function	Sulfate transmembrane transporter activity	IEA
GO:0015116	Function	Sulfate transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0015383	Function	Sulfate:bicarbonate antiporter activity	IEA
GO:0015383	Function	Sulfate:bicarbonate antiporter activity	ISS
GO:0015701	Process	Bicarbonate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11087667
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA
GO:0019531	Function	Oxalate transmembrane transporter activity	IEA
GO:0019531	Function	Oxalate transmembrane transporter activity	ISS
GO:0019532	Process	Oxalate transport	IEA
GO:0019532	Process	Oxalate transport	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IBA
GO:1902358	Process	Sulfate transmembrane transport	IBA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	ISS
GO:1902358	Process	Sulfate transmembrane transport	TAS
GO:1902476	Process	Chloride transmembrane transport	IBA

MIM	HGNC	e!Ensembl
610130	10993	ENSG00000145217

Protein

UniProt ID

Q9H2B4

Protein name

Sulfate anion transporter 1 (SAT-1) (Solute carrier family 26 member 1)

Protein function

Sodium-independent sulfate anion transporter (PubMed:12713736, PubMed:27125215). Can transport other anions including bicarbonate, thiosulfate and oxalate by mediating sulfate-thiosulfate, sulfate-hydrogencarbonate and sulfate-oxalate anion exch

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	69 → 477	Sulfate permease family	Family
PF01740	STAS	531 → 683	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed most abundantly in the kidney and liver, with lower levels in the pancreas, testis, brain, small intestine, colon, and lung. {ECO:0000269|PubMed:12713736}.

Sequence

MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVAAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLQSLYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAHL

Sequence length

701

Interactions

View interactions

	KEGG		Reactome
	Chemical carcinogenesis - reactive oxygen species		Transport and synthesis of PAPS Multifunctional anion exchangers

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Epileptic encephalopathy	epileptic encephalopathy	N/A	N/A	ClinVar
Nephrolithiasis	nephrolithiasis susceptibility caused by SLC26A1	N/A	N/A	GenCC
Nephronophthisis	nephrolithiasis, calcium oxalate	N/A	N/A	ClinVar
Polymyositis	Polymyositis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asthma	Associate	32240371
Diabetic Retinopathy	Associate	21873659
Kidney Calculi	Associate	27210743
Neoplasm Metastasis	Associate	34511489
Nephrolithiasis	Associate	27210743
Parkinson Disease	Associate	36672180

SLC26A1 (solute carrier family 26 member 1)