Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10861
Gene name	Solute carrier family 26 member 1
Gene symbol	SLC26A1
Synonyms (NCBI Gene)	CAONCAON1EDM4HYSULFSAT-1SAT1
Chromosome	4
Chromosome location	4p16.3
Summary	This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. T

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments
MIRT2624434	hsa-miR-1184	CLIP-seq
MIRT2624435	hsa-miR-1205	CLIP-seq
MIRT2624436	hsa-miR-3158-5p	CLIP-seq
MIRT2624437	hsa-miR-4279	CLIP-seq
MIRT2624438	hsa-miR-4435	CLIP-seq
MIRT2624439	hsa-miR-4768-5p	CLIP-seq
MIRT2624440	hsa-miR-942	CLIP-seq
MIRT2624434	hsa-miR-1184	CLIP-seq
MIRT2624435	hsa-miR-1205	CLIP-seq
MIRT2624436	hsa-miR-3158-5p	CLIP-seq
MIRT2624437	hsa-miR-4279	CLIP-seq
MIRT2624438	hsa-miR-4435	CLIP-seq
MIRT2624439	hsa-miR-4768-5p	CLIP-seq
MIRT2624440	hsa-miR-942	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	12713736, 27125215
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0006821	Process	Chloride transport	ISS
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA
GO:0015116	Function	Sulfate transmembrane transporter activity	IEA
GO:0015116	Function	Sulfate transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0015383	Function	Sulfate:bicarbonate antiporter activity	IEA
GO:0015383	Function	Sulfate:bicarbonate antiporter activity	ISS
GO:0015701	Process	Bicarbonate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11087667
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA
GO:0019531	Function	Oxalate transmembrane transporter activity	IEA
GO:0019531	Function	Oxalate transmembrane transporter activity	ISS
GO:0019532	Process	Oxalate transport	IEA
GO:0019532	Process	Oxalate transport	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IBA
GO:1902358	Process	Sulfate transmembrane transport	IBA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	ISS
GO:1902358	Process	Sulfate transmembrane transport	TAS
GO:1902476	Process	Chloride transmembrane transport	IBA

MIM	HGNC	e!Ensembl
610130	10993	ENSG00000145217

Q9H2B4

Protein name

Sulfate anion transporter 1 (SAT-1) (Solute carrier family 26 member 1)

Protein function

Sodium-independent sulfate anion transporter (PubMed:12713736, PubMed:27125215). Can transport other anions including bicarbonate, thiosulfate and oxalate by mediating sulfate-thiosulfate, sulfate-hydrogencarbonate and sulfate-oxalate anion exch

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	69 → 477	Sulfate permease family	Family
PF01740	STAS	531 → 683	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed most abundantly in the kidney and liver, with lower levels in the pancreas, testis, brain, small intestine, colon, and lung. {ECO:0000269|PubMed:12713736}.

Sequence

MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVAAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLQSLYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAHL

Sequence length

701

Interactions

View interactions

	KEGG		Reactome
	Chemical carcinogenesis - reactive oxygen species		Transport and synthesis of PAPS Multifunctional anion exchangers

248

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypersulfaturia	Pathogenic	rs1192140369	RCV003228882
Nephrolithiasis, calcium oxalate	Pathogenic	rs1192140369	RCV002463389

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Disorder of lung	Uncertain significance	rs199753982	RCV005861357
Epileptic encephalopathy	Uncertain significance	rs1057518652	RCV000415430
Hyperoxaluria	Uncertain significance	rs370208644, rs73219719, rs2534014668, rs2534015108	RCV003228804 RCV003228828 RCV003228830 RCV003228831
Mucopolysaccharidosis, MPS-I-H/S	Conflicting classifications of pathogenicity	rs558586992	RCV001198676
Nephrolithiasis susceptibility caused by SLC26A1	Uncertain significance; Conflicting classifications of pathogenicity; Benign	rs148721282, rs138449255, rs3796623, rs752562626, rs778314762, rs933082796, rs780694854, rs778406580, rs201921976, rs572968482, rs749514306, rs745511682, rs148726880, rs754967651, rs752630392 View all (64 more)	RCV005005177 RCV005040189 RCV004762152 RCV004763308 RCV005042532 RCV005032076 RCV005038494 RCV005038410 RCV005005306 RCV005002647 RCV005038482 RCV005002700 RCV005002701 RCV005002693 RCV005002731 RCV005002783 RCV005034759 RCV005034767 RCV005045355 RCV005034815 RCV005034779 RCV005036662 RCV005032337 RCV005044969 RCV005045067 RCV005045094 RCV005034543 RCV005034596 RCV005036531 RCV005045381 RCV005036539 RCV005036577 RCV005036586 RCV005047356 RCV005036602 RCV005036611 RCV005036617 RCV005036624 RCV005036688 RCV005031822 RCV005396826 RCV005003586 RCV005036711 RCV005036710 RCV005003608 RCV005047492 RCV005047503 RCV005047549 RCV005036795 RCV005036796 RCV005036851 RCV005036858 RCV005036848 RCV004763721 RCV005036940 RCV005036989 RCV005036962 RCV005036967 RCV005047811 RCV005036999 RCV004546815 RCV005040530 RCV005038571 RCV005038590 RCV005038616 RCV005038618 RCV004759336 RCV005038679 RCV004555436 RCV005357430 RCV005003447 RCV005031542 RCV005031543 RCV005005028 RCV005036446 RCV005040011 RCV005040019 RCV005036508 RCV005005151 RCV005038053
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	rs761530861	RCV005927009
SLC26A1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	rs59758572, rs144567476, rs547128457, rs35719765, rs144076450, rs150395578, rs923099050, rs139024319, rs148832260, rs376909897, rs1300301955, rs754470755, rs371320635, rs554618177, rs182088046 View all (8 more)	RCV003980604 RCV003913525 RCV003978736 RCV004756372 RCV003973541 RCV003926617 RCV004756485 RCV004755826 RCV004755827 RCV003392772 RCV003402730 RCV003946648 RCV003909035 RCV004756528 RCV003981074 RCV003956576 RCV003942083 RCV003934722 RCV003925520 RCV003915814 RCV003940533 RCV003952478 RCV004756194

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	32240371
Diabetic Retinopathy	Associate	21873659
Kidney Calculi	Associate	27210743
Neoplasm Metastasis	Associate	34511489
Nephrolithiasis	Associate	27210743
Parkinson Disease	Associate	36672180

SLC26A1 (solute carrier family 26 member 1)