Gene Gene information from NCBI Gene database.
Entrez ID 10859
Gene name Leukocyte immunoglobulin like receptor B1
Gene symbol LILRB1
Synonyms (NCBI Gene)
CD85JILT-2ILT2LIR-1LIR1MIR-7MIR7PIR-BPIRB
Chromosome 19
Chromosome location 19q13.42
Summary This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular
miRNA miRNA information provided by mirtarbase database.
488
miRTarBase ID miRNA Experiments Reference
MIRT609970 hsa-miR-8485 HITS-CLIP 21572407
MIRT609969 hsa-miR-329-3p HITS-CLIP 21572407
MIRT609968 hsa-miR-362-3p HITS-CLIP 21572407
MIRT609967 hsa-miR-603 HITS-CLIP 21572407
MIRT625538 hsa-miR-4789-3p HITS-CLIP 21572407
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
TRERF1 Repression 18652845
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
64
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IDA 24052308
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IDA 21213105
GO:0002230 Process Positive regulation of defense response to virus by host IDA 18398485
GO:0002250 Process Adaptive immune response IEA
GO:0002309 Process T cell proliferation involved in immune response IDA 18094328
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604811 6605 ENSG00000104972
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHL6
Protein name Leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD
Protein function Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles (PubMed:16455647, PubMed:28636952). Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inh
PDB 1G0X , 1P7Q , 1UFU , 1UGN , 1VDG , 3D2U , 4LL9 , 4NO0 , 5KNM , 6AEE , 6EWA , 6EWC , 6EWO , 6K60 , 6ZDX , 7KFK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 118 Immunoglobulin domain Domain
PF00047 ig 329 410 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B cells, monocytes and various dendritic cell (DC) subsets including myeloid, plasmacytoid and tolerogenic DCs (at protein level) (PubMed:20448110, PubMed:24453251, PubMed:9285411, PubMed:9842885). Expressed in decidual ma
Sequence
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRL
YREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVV
TG
AYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRA
IFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEE
TLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGA
HNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKE
GAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTH
PSDPLELVVS
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLF
LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQ
PEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD
TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH
Sequence length 650
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Osteoclast differentiation
B cell receptor signaling pathway
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Melanoma - rs148543880 RCV006148009
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 26973020
Acidosis Associate 38069241
Adenocarcinoma of Lung Associate 28618418, 29806739, 35844799, 35984198
Adenoma Stimulate 25584614
Alzheimer Disease Associate 36010613
Anemia Sickle Cell Associate 37686397
Arthritis Juvenile Associate 25853899
Arthritis Rheumatoid Associate 26314621, 30711014, 32468016
Autism Spectrum Disorder Associate 36761165, 37545517
Autoimmune Diseases Associate 19912253, 24799764, 26314621, 36104364