Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10858
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome P450 family 46 subfamily A member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYP46A1
Synonyms (NCBI Gene) Gene synonyms aliases	CP46, CYP46
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic r

Show/Hide all(54)

miRTarBase ID	miRNA	Experiments
MIRT921586	hsa-let-7a	CLIP-seq
MIRT921587	hsa-let-7b	CLIP-seq
MIRT921588	hsa-let-7c	CLIP-seq
MIRT921589	hsa-let-7d	CLIP-seq
MIRT921590	hsa-let-7e	CLIP-seq
MIRT921591	hsa-let-7f	CLIP-seq
MIRT921592	hsa-let-7g	CLIP-seq
MIRT921593	hsa-let-7i	CLIP-seq
MIRT921594	hsa-miR-1254	CLIP-seq
MIRT921595	hsa-miR-125a-3p	CLIP-seq
MIRT921596	hsa-miR-1293	CLIP-seq
MIRT921597	hsa-miR-2467-3p	CLIP-seq
MIRT921598	hsa-miR-3116	CLIP-seq
MIRT921599	hsa-miR-3152-3p	CLIP-seq
MIRT921600	hsa-miR-3177-3p	CLIP-seq
MIRT921601	hsa-miR-3179	CLIP-seq
MIRT921602	hsa-miR-3612	CLIP-seq
MIRT921603	hsa-miR-4254	CLIP-seq
MIRT921604	hsa-miR-4257	CLIP-seq
MIRT921605	hsa-miR-4294	CLIP-seq
MIRT921606	hsa-miR-4302	CLIP-seq
MIRT921607	hsa-miR-4419a	CLIP-seq
MIRT921608	hsa-miR-4443	CLIP-seq
MIRT921609	hsa-miR-4458	CLIP-seq
MIRT921610	hsa-miR-4461	CLIP-seq
MIRT921611	hsa-miR-4483	CLIP-seq
MIRT921612	hsa-miR-4500	CLIP-seq
MIRT921613	hsa-miR-4510	CLIP-seq
MIRT921614	hsa-miR-4694-5p	CLIP-seq
MIRT921615	hsa-miR-4697-3p	CLIP-seq
MIRT921616	hsa-miR-4722-3p	CLIP-seq
MIRT921617	hsa-miR-4729	CLIP-seq
MIRT921618	hsa-miR-505	CLIP-seq
MIRT921619	hsa-miR-541	CLIP-seq
MIRT921620	hsa-miR-552	CLIP-seq
MIRT921621	hsa-miR-564	CLIP-seq
MIRT921622	hsa-miR-650	CLIP-seq
MIRT921623	hsa-miR-654-5p	CLIP-seq
MIRT921624	hsa-miR-661	CLIP-seq
MIRT921625	hsa-miR-877	CLIP-seq
MIRT921626	hsa-miR-922	CLIP-seq
MIRT921627	hsa-miR-98	CLIP-seq
MIRT1973034	hsa-miR-3184	CLIP-seq
MIRT1973035	hsa-miR-3611	CLIP-seq
MIRT1973036	hsa-miR-423-5p	CLIP-seq
MIRT1973037	hsa-miR-4455	CLIP-seq
MIRT1973038	hsa-miR-4690-5p	CLIP-seq
MIRT2208687	hsa-miR-3158-3p	CLIP-seq
MIRT2208688	hsa-miR-3689d	CLIP-seq
MIRT2208689	hsa-miR-432	CLIP-seq
MIRT921608	hsa-miR-4443	CLIP-seq
MIRT2208690	hsa-miR-4721	CLIP-seq
MIRT2208691	hsa-miR-4779	CLIP-seq
MIRT2208692	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP3	Unknown	20930312

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	10377398
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0006707	Process	Cholesterol catabolic process	IBA	21873635
GO:0006707	Process	Cholesterol catabolic process	IDA	14640697, 18621681, 25017465
GO:0006707	Process	Cholesterol catabolic process	IEA
GO:0006707	Process	Cholesterol catabolic process	ISS
GO:0006805	Process	Xenobiotic metabolic process	IDA	20667828
GO:0007399	Process	Nervous system development	TAS	10377398
GO:0008395	Function	Steroid hydroxylase activity	IDA	14640697
GO:0016021	Component	Integral component of membrane	IEA
GO:0016125	Process	Sterol metabolic process	TAS
GO:0020037	Function	Heme binding	IBA	21873635
GO:0020037	Function	Heme binding	IDA	18621681, 20667828, 23288837
GO:0030425	Component	Dendrite	ISS
GO:0033781	Function	Cholesterol 24-hydroxylase activity	IBA	21873635
GO:0033781	Function	Cholesterol 24-hydroxylase activity	IDA	14640697, 18621681, 25017465
GO:0033781	Function	Cholesterol 24-hydroxylase activity	TAS
GO:0042448	Process	Progesterone metabolic process	IDA	14640697
GO:0098793	Component	Presynapse	ISS
GO:0098794	Component	Postsynapse	ISS
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS
GO:1903044	Process	Protein localization to membrane raft	ISS

MIM	HGNC	e!Ensembl
604087	2641	ENSG00000036530

Protein

UniProt ID

Q9Y6A2

Protein name

Cholesterol 24-hydroxylase (CH24H) (EC 1.14.14.25) (Cholesterol 24-monooxygenase) (Cholesterol 24S-hydroxylase) (Cytochrome P450 46A1)

Protein function

P450 monooxygenase that plays a major role in cholesterol homeostasis in the brain. Primarily catalyzes the hydroxylation (with S stereochemistry) at C-24 of cholesterol side chain, triggering cholesterol diffusion out of neurons and its further

PDB

2Q9F , 2Q9G , 3MDM , 3MDR , 3MDT , 3MDV , 4ENH , 4FIA , 4J14 , 7LRL , 7LS3 , 7LS4 , 7N3L , 7N3M , 7N6F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	34 → 484	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. The mRNA was broadly distributed with higher levels in gray matter zones and lower levels in regions rich in white matter. Not detected in fetal sample but its expression increases linearly with age. {ECO:0000269|Pu

Sequence

MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVL
QDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERL
FGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSM
QDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQL
REVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
IAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKES
LRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA
PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLD
PVLCTLRPRGWQPAPPPPPC

Sequence length

500

Interactions

View interactions

	KEGG		Reactome
	Primary bile acid biosynthesis		Synthesis of bile acids and bile salts via 24-hydroxycholesterol Endogenous sterols

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	19286353

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Coronary artery disease	Coronary artery disease	GWAS
Oligodendroglioma	Oligodendroglioma	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	15165699, 16734927, 19553612, 19647891, 20193040, 27056331
Breast Neoplasms	Associate	37491786
Cerebral Hemorrhage	Associate	26795600
Cognition Disorders	Associate	15165699
Colorectal Neoplasms	Associate	27341022
Glaucoma Open Angle	Associate	19553612, 21386929, 27162448
Glioblastoma	Inhibit	31777202
Glioma	Inhibit	31777202
Hemangioma Cavernous Central Nervous System	Associate	26795600
Mental Disorders	Associate	36482560
Neoplasms	Associate	27341022
Neoplasms	Inhibit	31777202
Neurodegenerative Diseases	Associate	19553612
Niemann Pick Disease Type C	Associate	36482560

CYP46A1 (cytochrome P450 family 46 subfamily A member 1)