Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10857
Gene name Gene Name - the full gene name approved by the HGNC.
Progesterone receptor membrane component 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PGRMC1
Synonyms (NCBI Gene) Gene synonyms aliases
Dap1, HPR6.6, IZA, MPR
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq24
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001609 hsa-let-7b-5p pSILAC 18668040
MIRT027601 hsa-miR-98-5p Microarray 19088304
MIRT001609 hsa-let-7b-5p Proteomics;Other 18668040
MIRT050203 hsa-miR-25-3p CLASH 23622248
MIRT044164 hsa-miR-130b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0005496 Function Steroid binding IEA
GO:0005496 Function Steroid binding TAS 9705155
GO:0005515 Function Protein binding IPI 21081644, 26988023, 27599036, 28514442, 30021884, 30443021, 32296183, 33961781, 35271311, 37047353
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300435 16090 ENSG00000101856
Protein
UniProt ID O00264
Protein name Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA)
Protein function Component of a progesterone-binding protein complex (PubMed:28396637). Binds progesterone (PubMed:25675345). Has many reported cellular functions (heme homeostasis, interaction with CYPs). Required for the maintenance of uterine histoarchitectur
PDB 4X8Y
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00173 Cyt-b5 74 171 Cytochrome b5-like Heme/Steroid binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:36213313, PubMed:37453717). Expressed by endometrial glands and stroma (at protein level) (PubMed:23793472). Widely expressed, with highest expression in liver and kidney. {ECO:0000269|PubMe
Sequence
MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLL
KEGEEPTVY
SDEEEPKDESARKND
Sequence length 195
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Neutrophil degranulation
<