PPP1R17 (protein phosphatase 1 regulatory subunit 17)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10842
Gene name Protein phosphatase 1 regulatory subunit 17
Gene symbol PPP1R17
Synonyms (NCBI Gene)
C7orf16GSBS
Chromosome 7
Chromosome location 7p14.3
Summary The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that incre
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT016789 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IBA
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IEA
GO:0007417 Process Central nervous system development NAS 10051666
GO:0010921 Process Regulation of phosphatase activity ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604088 16973 ENSG00000106341
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O96001
Protein name Protein phosphatase 1 regulatory subunit 17 (G-substrate)
Protein function Inhibits phosphatase activities of protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) complexes.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in cerebellum.
Sequence 
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQ
KKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTP
ALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Sequence length 155
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Long-term depression  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hypercholesterolemia Uncertain significance rs267601485 RCV004701238
Hypercholesterolemia, familial, 1 Uncertain significance rs201857392 RCV005399165
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 37794108
Colonic Neoplasms Associate 37023088