Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10842
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 1 regulatory subunit 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP1R17
Synonyms (NCBI Gene) Gene synonyms aliases
C7orf16, GSBS
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that incre
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016789 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IBA
GO:0004865 Function Protein serine/threonine phosphatase inhibitor activity IEA
GO:0007417 Process Central nervous system development NAS 10051666
GO:0010921 Process Regulation of phosphatase activity ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604088 16973 ENSG00000106341
Protein
UniProt ID O96001
Protein name Protein phosphatase 1 regulatory subunit 17 (G-substrate)
Protein function Inhibits phosphatase activities of protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) complexes.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in cerebellum.
Sequence
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQ
KKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTP
ALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Sequence length 155
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Long-term depression  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypercholesterolemia hypercholesterolemia N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 37794108
Colonic Neoplasms Associate 37023088