FAXDC2 (fatty acid hydroxylase domain containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10826
Gene name Gene Name - the full gene name approved by the HGNC.
Fatty acid hydroxylase domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FAXDC2
Synonyms (NCBI Gene) Gene synonyms aliases
C5orf4
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT022435 hsa-miR-124-3p Microarray 18668037
MIRT030819 hsa-miR-21-5p Microarray 18591254
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0000254 Function C-4 methylsterol oxidase activity IBA 21873635
GO:0001934 Process Positive regulation of protein phosphorylation IMP 27689744
GO:0005506 Function Iron ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 27689744
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619853 1334 ENSG00000170271
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96IV6
Protein name Fatty acid hydroxylase domain-containing protein 2
Protein function Promotes megakaryocyte differentiation by enhancing ERK phosphorylation and up-regulating RUNX1 expression.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04116 FA_hydroxylase 175 → 299 Fatty acid hydroxylase superfamily Family
Tissue specificity TISSUE SPECIFICITY: Down-regulated in primary acute myeloid leukemia (AML) patients. {ECO:0000269|PubMed:27689744}.
Sequence 
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
Sequence length 333
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504