Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10810
Gene name Gene Name - the full gene name approved by the HGNC.
WASP family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WASF3
Synonyms (NCBI Gene) Gene synonyms aliases
Brush-1, SCAR3, WAVE3
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q12.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004296 hsa-miR-200b-3p Luciferase reporter assay, qRT-PCR 19801681
MIRT004296 hsa-miR-200b-3p Luciferase reporter assay, qRT-PCR 19801681
MIRT004296 hsa-miR-200b-3p Luciferase reporter assay, qRT-PCR 19801681
MIRT004524 hsa-miR-200a-3p Luciferase reporter assay 19801681
MIRT004296 hsa-miR-200b-3p Luciferase reporter assay 19801681
Transcription factors
Transcription factor Regulation Reference
HIF1A Activation 22581642
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005856 Component Cytoskeleton IEA
GO:0007010 Process Cytoskeleton organization IMP 21834987
GO:0008360 Process Regulation of cell shape IMP 21834987
GO:0014003 Process Oligodendrocyte development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605068 12734 ENSG00000132970
Protein
UniProt ID Q9UPY6
Protein name Actin-binding protein WASF3 (Protein WAVE-3) (Verprolin homology domain-containing protein 3) (Wiskott-Aldrich syndrome protein family member 3) (WASP family protein member 3)
Protein function Downstream effector molecules involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the co
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02205 WH2 437 464 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Expressed in ovary and brain.
Sequence
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
Sequence length 502
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Adherens junction
Fc gamma R-mediated phagocytosis
Pathogenic Escherichia coli infection
Salmonella infection
Choline metabolism in cancer
  Regulation of actin dynamics for phagocytic cup formation
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Cone-rod dystrophy Cone-Rod Dystrophies rs200691042, rs121908281, rs28940314, rs121434337, rs80338903, rs121909398, rs28937883, rs397515360, rs137853006, rs786205085, rs137853040, rs137853041, rs786205086, rs104894671, rs1568626209
View all (207 more)
28041643
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 29610475
Unknown
Disease term Disease name Evidence References Source
Eosinophilia Eosinophilia GWAS
Coronary artery disease Coronary artery disease GWAS
Dyslexia Dyslexia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37322027
Breast Neoplasms Associate 21105030, 21544801, 22909346, 22952619, 23318438, 36949468, 37176055
Carcinogenesis Associate 19567454, 27642088
Hypoxia Stimulate 22581642
Hypoxia Brain Stimulate 22581642
Leiomyoma Associate 19567454
Lymphatic Metastasis Stimulate 29845225
Neoplasm Metastasis Associate 19801681, 21105030, 22315230, 22581642, 22952619, 23677069, 25329315, 26676744, 28233357, 36949468, 37176055
Neoplasm Metastasis Inhibit 22289355
Neoplasm Metastasis Stimulate 23318438