Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1081
Gene name	Glycoprotein hormones, alpha polypeptide
Gene symbol	CGA
Synonyms (NCBI Gene)	CG-ALPHAFSHAGPA1GPHA1GPHaHCGLHATSHA
Chromosome	6
Chromosome location	6q14.3
Summary	The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The a

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018742	hsa-miR-335-5p	Microarray	18185580
MIRT888049	hsa-miR-2682	CLIP-seq
MIRT888050	hsa-miR-320a	CLIP-seq
MIRT888051	hsa-miR-320b	CLIP-seq
MIRT888052	hsa-miR-320c	CLIP-seq
MIRT888053	hsa-miR-320d	CLIP-seq
MIRT888054	hsa-miR-3714	CLIP-seq
MIRT888055	hsa-miR-4429	CLIP-seq
MIRT888056	hsa-miR-449c	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
ATF1	Unknown	10341006
CREB1	Unknown	10341006
DLX3	Activation	22446105
ETS2	Activation	15637148
MSX1	Unknown	18379900
NANOG	Repression	15983365
POU1F1	Unknown	11081207
TFAP2A	Unknown	10648798
THRA	Unknown	9709914
THRB	Repression	2480596
THRB	Unknown	9709914

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	IMP	11207219
GO:0005515	Function	Protein binding	IPI	7922031, 11222739, 15662415, 22802634, 31467278
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2494176, 24692546
GO:0005796	Component	Golgi lumen	TAS
GO:0006590	Process	Thyroid hormone generation	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	24692546
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	20613903
GO:0008406	Process	Gonad development	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	NAS	7922031, 25280580, 29935915
GO:0010469	Process	Regulation of signaling receptor activity	IDA	24692546
GO:0010893	Process	Positive regulation of steroid biosynthetic process	IDA	2494176
GO:0016913	Function	Follicle-stimulating hormone activity	IBA
GO:0016913	Function	Follicle-stimulating hormone activity	IDA	2494176, 24692546
GO:0016913	Function	Follicle-stimulating hormone activity	IEA
GO:0016914	Component	Follicle-stimulating hormone complex	IBA
GO:0016914	Component	Follicle-stimulating hormone complex	IDA	2494176, 24692546
GO:0016914	Component	Follicle-stimulating hormone complex	IEA
GO:0016914	Component	Follicle-stimulating hormone complex	IPI	11222739
GO:0030335	Process	Positive regulation of cell migration	NAS	20613903
GO:0030878	Process	Thyroid gland development	IEA
GO:0032275	Process	Luteinizing hormone secretion	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0035265	Process	Organ growth	IEA
GO:0042699	Process	Follicle-stimulating hormone signaling pathway	NAS	11222739
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	20613903
GO:0046621	Process	Negative regulation of organ growth	IEA
GO:0046884	Process	Follicle-stimulating hormone secretion	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0061696	Component	Pituitary gonadotropin complex	IPI	7922031
GO:0061696	Component	Pituitary gonadotropin complex	NAS	25280580, 29935915

MIM	HGNC	e!Ensembl
118850	1885	ENSG00000135346

P01215

Protein name

Glycoprotein hormones alpha chain (Anterior pituitary glycoprotein hormones common subunit alpha) (Choriogonadotropin alpha chain) (Chorionic gonadotrophin subunit alpha) (CG-alpha) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Follitropin alpha

Protein function

Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specif

PDB

1DZ7 , 1E9J , 1FL7 , 1HCN , 1HD4 , 1HRP , 1QFW , 1XWD , 4AY9 , 4MQW , 7FIG , 7FIH , 7FII , 7T9I , 7UTZ , 7XW5 , 8I2G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00236	Hormone_6	23 → 116	Glycoprotein hormone	Domain

Sequence

MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence length

116

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling GnRH signaling pathway Ovarian steroidogenesis Prolactin signaling pathway Thyroid hormone synthesis Regulation of lipolysis in adipocytes GnRH secretion Autoimmune thyroid disease		Androgen biosynthesis Mineralocorticoid biosynthesis Glycoprotein hormones Thyroxine biosynthesis Hormone ligand-binding receptors G alpha (s) signalling events TFAP2 (AP-2) family regulates transcription of growth factors and their receptors ADORA2B mediated anti-inflammatory cytokines production Reactions specific to the complex N-glycan synthesis pathway

CGA (glycoprotein hormones, alpha polypeptide)