Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10809
Gene name Gene Name - the full gene name approved by the HGNC.	StAR related lipid transfer domain containing 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STARD10
Synonyms (NCBI Gene) Gene synonyms aliases	CGI-52, NY-CO-28, PCTP2, SDCCAG28
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003632	hsa-miR-661	immunoblot, qRT-PCR	20543867
MIRT731281	hsa-miR-638	Immunoblot, Luciferase reporter assay, qRT-PCR	28412359
MIRT731281	hsa-miR-638	Immunoblot, Luciferase reporter assay, qRT-PCR	28412359
MIRT731281	hsa-miR-638	Immunoblot, Luciferase reporter assay, qRT-PCR	28412359
MIRT731281	hsa-miR-638	Immunoblot, Luciferase reporter assay, qRT-PCR	28412359
MIRT1395133	hsa-miR-103a	CLIP-seq
MIRT1395134	hsa-miR-107	CLIP-seq
MIRT1395135	hsa-miR-1184	CLIP-seq
MIRT1395136	hsa-miR-1227	CLIP-seq
MIRT1395137	hsa-miR-1275	CLIP-seq
MIRT1395138	hsa-miR-1538	CLIP-seq
MIRT1395139	hsa-miR-198	CLIP-seq
MIRT1395140	hsa-miR-3065-3p	CLIP-seq
MIRT1395141	hsa-miR-3175	CLIP-seq
MIRT1395142	hsa-miR-4260	CLIP-seq
MIRT1395143	hsa-miR-4283	CLIP-seq
MIRT1395144	hsa-miR-4447	CLIP-seq
MIRT1395145	hsa-miR-4472	CLIP-seq
MIRT1395146	hsa-miR-4489	CLIP-seq
MIRT1395147	hsa-miR-4525	CLIP-seq
MIRT1395148	hsa-miR-4665-5p	CLIP-seq
MIRT1395149	hsa-miR-4715-3p	CLIP-seq
MIRT1395150	hsa-miR-4723-5p	CLIP-seq
MIRT1395151	hsa-miR-4728-5p	CLIP-seq
MIRT1395152	hsa-miR-4733-3p	CLIP-seq
MIRT1395153	hsa-miR-4745-3p	CLIP-seq
MIRT1395154	hsa-miR-4755-3p	CLIP-seq
MIRT1395155	hsa-miR-4783-3p	CLIP-seq
MIRT1395156	hsa-miR-625	CLIP-seq
MIRT1395157	hsa-miR-760	CLIP-seq
MIRT1395158	hsa-miR-764	CLIP-seq
MIRT1395139	hsa-miR-198	CLIP-seq
MIRT1395142	hsa-miR-4260	CLIP-seq
MIRT1395143	hsa-miR-4283	CLIP-seq
MIRT1395146	hsa-miR-4489	CLIP-seq
MIRT1395154	hsa-miR-4755-3p	CLIP-seq
MIRT1395157	hsa-miR-760	CLIP-seq
MIRT2340614	hsa-miR-106a	CLIP-seq
MIRT2340615	hsa-miR-106b	CLIP-seq
MIRT1395137	hsa-miR-1275	CLIP-seq
MIRT2340616	hsa-miR-1286	CLIP-seq
MIRT2340617	hsa-miR-17	CLIP-seq
MIRT2340618	hsa-miR-20a	CLIP-seq
MIRT2340619	hsa-miR-20b	CLIP-seq
MIRT1395141	hsa-miR-3175	CLIP-seq
MIRT1395144	hsa-miR-4447	CLIP-seq
MIRT1395145	hsa-miR-4472	CLIP-seq
MIRT1395147	hsa-miR-4525	CLIP-seq
MIRT1395148	hsa-miR-4665-5p	CLIP-seq
MIRT1395149	hsa-miR-4715-3p	CLIP-seq
MIRT2340620	hsa-miR-4722-5p	CLIP-seq
MIRT1395150	hsa-miR-4723-5p	CLIP-seq
MIRT1395151	hsa-miR-4728-5p	CLIP-seq
MIRT1395152	hsa-miR-4733-3p	CLIP-seq
MIRT2340621	hsa-miR-519a	CLIP-seq
MIRT2340622	hsa-miR-519b-3p	CLIP-seq
MIRT2340623	hsa-miR-519c-3p	CLIP-seq
MIRT2340624	hsa-miR-519d	CLIP-seq
MIRT1395156	hsa-miR-625	CLIP-seq
MIRT1395158	hsa-miR-764	CLIP-seq
MIRT2340625	hsa-miR-93	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23455924
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005902	Component	Microvillus	IBA
GO:0005929	Component	Cilium	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046581	Component	Intercellular canaliculus	IBA

MIM	HGNC	e!Ensembl
617382	10666	ENSG00000214530

Protein

UniProt ID

Q9Y365

Protein name

START domain-containing protein 10 (StARD10) (Antigen NY-CO-28) (PCTP-like protein) (PCTP-L) (Serologically defined colon cancer antigen 28) (StAR-related lipid transfer protein 10)

Protein function

May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1

PDB

6SER

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01852	START	28 → 226	START domain	Domain

Sequence

MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVE
MDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWR
CPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKS
CVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPE
QSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

Sequence length

291

Interactions

View interactions

	Reactome
			Synthesis of PC

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	20543867, 36077333
Diabetes Mellitus Type 2	Associate	33535042
Tremor	Associate	34320404

STARD10 (StAR related lipid transfer domain containing 10)