ENTR1 (endosome associated trafficking regulator 1)

Gene

• Entrez ID: 10807
• Gene name: Endosome associated trafficking regulator 1
• Gene symbol: ENTR1
• Synonyms (NCBI Gene): NY-CO-3, SDCCAG3, SDDAG3
• Chromosome: 9
• Chromosome location: 9q34.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23108400, 25278552, 25416956, 26871637, 27767179, 27812135
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	25278552
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	23108400
GO:0005769	Component	Early endosome	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	27767179
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015031	Process	Protein transport	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	23108400
GO:0030496	Component	Midbody	IEA
GO:0030904	Component	Retromer complex	IDA	25278552
GO:0032456	Process	Endocytic recycling	IMP	25278552
GO:0032465	Process	Regulation of cytokinesis	IBA
GO:0032465	Process	Regulation of cytokinesis	IDA	23108400
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IDA	27767179
GO:0042995	Component	Cell projection	IEA
GO:0045724	Process	Positive regulation of cilium assembly	IBA
GO:0045724	Process	Positive regulation of cilium assembly	IMP	27767179
GO:0051301	Process	Cell division	IEA
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	23108400
GO:0055037	Component	Recycling endosome	IEA
GO:1903566	Process	Positive regulation of protein localization to cilium	IBA
GO:1903566	Process	Positive regulation of protein localization to cilium	IMP	27767179

Other IDs

• MIM: 618289
• HGNC: 10667
• e!Ensembl: ENSG00000165689

Protein

• UniProt ID: Q96C92
• Protein name: Endosome-associated-trafficking regulator 1 (Antigen NY-CO-3) (Serologically defined colon cancer antigen 3)
• Protein function: Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis (PubMed:23108400, PubMed:25278552, PubMed:27767179). Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer
• Tissue specificity: TISSUE SPECIFICITY: Expressed in the colon (at protein level). {ECO:0000269|PubMed:23108400}.
• Sequence:

  MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMC
  YVPSPVLASVGDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNL
  GLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDE
  DTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVS
  PASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVR
  TLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVS
  NFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILK
  SIDRISEVKDEEEDS

• Sequence length: 435