SMIM38 (small integral membrane protein 38)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 107984345
Gene name Small integral membrane protein 38
Gene symbol SMIM38
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A286YFK9
Protein name Small integral membrane protein 38
Family and domains
Sequence 
MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD
Sequence length 51
Interactions View interactions