ZNF460 (zinc finger protein 460)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10794
Gene name Zinc finger protein 460
Gene symbol ZNF460
Synonyms (NCBI Gene)
HZF8ZNF272
Chromosome 19
Chromosome location 19q13.43
Summary Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating
miRNA miRNA information provided by mirtarbase database.
2373
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2373)
miRTarBase ID miRNA Experiments Reference
MIRT017831 hsa-miR-335-5p Microarray 18185580
MIRT025798 hsa-miR-7-5p Sequencing 20371350
MIRT046761 hsa-miR-222-3p CLASH 23622248
MIRT722719 hsa-miR-548ac HITS-CLIP 19536157
MIRT722718 hsa-miR-548bb-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604755 21628 ENSG00000197714
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14592
Protein name Zinc finger protein 460 (Zinc finger protein 272) (Zinc finger protein HZF8)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 12 → 53 KRAB box Family
PF00096 zf-C2H2 196 → 218 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 224 → 246 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 252 → 274 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 280 → 302 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 364 → 386 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 392 → 414 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 420 → 442 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 476 → 498 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed at low levels. Highest levels are found in pancreas and liver. {ECO:0000269|PubMed:15004467}.
Sequence 
MAAAWMAPAQESVTFEDVAVTFTQEEWGQLDVTQRALYVEVMLETCGLLVALGDSTKPET
VEPIPSHLALPEEVSLQEQLAQGVPRYSYLGQAMDQDGPSEMQEYFLRPGTDPQSEKLHG
KMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNEN
CFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFNRRSHLT
RHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSNFVLHNK
SHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCRSHLKQHERIHTG
EKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGKAFSIRKDLIRHFNIHTGEKPY
ECLQCGKAFTRMSGLTRHQWIHTGEKPYVCIQCGKAFCRTTNLIRHFSIHTGEKPYECVE
CGKAFNRRSPLTRHQRIHTAEKSHEPIQSGNVSCESTDLIQHSIIHTESSPVSAVNMETP
SIAAHSSSLDINGFIVEETLPL
Sequence length 562
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
ATR X syndrome Associate 34738503
★★★★★
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Stimulate 37057209
★★★★★
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Associate 35442145
★★★★★
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Associate 34738503, 36639776
★★★★★
★☆☆☆☆
Found in Text Mining only