Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10769
Gene name Gene Name - the full gene name approved by the HGNC.	Polo like kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLK2
Synonyms (NCBI Gene) Gene synonyms aliases	SNK, hPlk2, hSNK
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the polo family of serine/threonine protein kinases that have a role in normal cell division. This gene is most abundantly expressed in testis, spleen and fetal tissues, and its expression is inducible by se

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000344	hsa-miR-126-3p	Review	20029422
MIRT004642	hsa-miR-126-5p	Review	20029422
MIRT000344	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR	18832181
MIRT000344	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR	18832181
MIRT023782	hsa-miR-1-3p	Microarray	18668037
MIRT027672	hsa-miR-98-5p	Microarray	19088304
MIRT000344	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	24969300
MIRT000344	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	24969300
MIRT535132	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT535131	hsa-miR-8076	PAR-CLIP	22012620
MIRT535130	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT535129	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT535128	hsa-miR-4529-5p	PAR-CLIP	22012620
MIRT535127	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT535126	hsa-miR-3187-3p	PAR-CLIP	22012620
MIRT731598	hsa-miR-27b-3p	Luciferase reporter assay	26910911
MIRT731598	hsa-miR-27b-3p	Luciferase reporter assay	26910911
MIRT731598	hsa-miR-27b-3p	Luciferase reporter assay	26910911
MIRT731598	hsa-miR-27b-3p	Luciferase reporter assay	26910911
MIRT731598	hsa-miR-27b-3p	Luciferase reporter assay	26910911
MIRT535132	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT535131	hsa-miR-8076	PAR-CLIP	22012620
MIRT535130	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT535129	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT535128	hsa-miR-4529-5p	PAR-CLIP	22012620
MIRT535127	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT535126	hsa-miR-3187-3p	PAR-CLIP	22012620
MIRT000344	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT000344	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT1242887	hsa-miR-128	CLIP-seq
MIRT1242888	hsa-miR-137	CLIP-seq
MIRT1242889	hsa-miR-1470	CLIP-seq
MIRT1242890	hsa-miR-149	CLIP-seq
MIRT1242891	hsa-miR-1587	CLIP-seq
MIRT1242892	hsa-miR-200b	CLIP-seq
MIRT1242893	hsa-miR-200c	CLIP-seq
MIRT1242894	hsa-miR-203	CLIP-seq
MIRT1242895	hsa-miR-2054	CLIP-seq
MIRT1242896	hsa-miR-27a	CLIP-seq
MIRT1242897	hsa-miR-27b	CLIP-seq
MIRT1242898	hsa-miR-3064-5p	CLIP-seq
MIRT1242899	hsa-miR-3127-3p	CLIP-seq
MIRT1242900	hsa-miR-3161	CLIP-seq
MIRT1242901	hsa-miR-3180-5p	CLIP-seq
MIRT1242902	hsa-miR-320a	CLIP-seq
MIRT1242903	hsa-miR-320b	CLIP-seq
MIRT1242904	hsa-miR-320c	CLIP-seq
MIRT1242905	hsa-miR-320d	CLIP-seq
MIRT1242906	hsa-miR-339-5p	CLIP-seq
MIRT1242907	hsa-miR-342-3p	CLIP-seq
MIRT1242908	hsa-miR-3617	CLIP-seq
MIRT1242909	hsa-miR-3662	CLIP-seq
MIRT1242910	hsa-miR-3909	CLIP-seq
MIRT1242911	hsa-miR-3935	CLIP-seq
MIRT1242912	hsa-miR-4275	CLIP-seq
MIRT1242913	hsa-miR-4287	CLIP-seq
MIRT1242914	hsa-miR-429	CLIP-seq
MIRT1242915	hsa-miR-4300	CLIP-seq
MIRT1242916	hsa-miR-4325	CLIP-seq
MIRT1242917	hsa-miR-4429	CLIP-seq
MIRT1242918	hsa-miR-4469	CLIP-seq
MIRT1242919	hsa-miR-4477a	CLIP-seq
MIRT1242920	hsa-miR-4492	CLIP-seq
MIRT1242921	hsa-miR-4498	CLIP-seq
MIRT1242922	hsa-miR-4520a-5p	CLIP-seq
MIRT1242923	hsa-miR-4520b-5p	CLIP-seq
MIRT1242924	hsa-miR-4656	CLIP-seq
MIRT1242925	hsa-miR-4667-3p	CLIP-seq
MIRT1242926	hsa-miR-4674	CLIP-seq
MIRT1242927	hsa-miR-4675	CLIP-seq
MIRT1242928	hsa-miR-4685-3p	CLIP-seq
MIRT1242929	hsa-miR-4691-3p	CLIP-seq
MIRT1242930	hsa-miR-4695-3p	CLIP-seq
MIRT1242931	hsa-miR-4741	CLIP-seq
MIRT1242932	hsa-miR-4794	CLIP-seq
MIRT1242933	hsa-miR-4803	CLIP-seq
MIRT1242934	hsa-miR-485-3p	CLIP-seq
MIRT1242935	hsa-miR-505	CLIP-seq
MIRT1242936	hsa-miR-513a-5p	CLIP-seq
MIRT1242937	hsa-miR-522	CLIP-seq
MIRT1242938	hsa-miR-561	CLIP-seq
MIRT1242939	hsa-miR-641	CLIP-seq
MIRT1242940	hsa-miR-670	CLIP-seq
MIRT1242941	hsa-miR-762	CLIP-seq
MIRT1242942	hsa-miR-873	CLIP-seq
MIRT1242943	hsa-miR-9	CLIP-seq
MIRT1242944	hsa-miR-920	CLIP-seq
MIRT1242945	hsa-miR-935	CLIP-seq
MIRT2071794	hsa-miR-1182	CLIP-seq
MIRT1242887	hsa-miR-128	CLIP-seq
MIRT2071795	hsa-miR-1289	CLIP-seq
MIRT1242891	hsa-miR-1587	CLIP-seq
MIRT1242895	hsa-miR-2054	CLIP-seq
MIRT1242896	hsa-miR-27a	CLIP-seq
MIRT1242897	hsa-miR-27b	CLIP-seq
MIRT2071796	hsa-miR-3148	CLIP-seq
MIRT1242906	hsa-miR-339-5p	CLIP-seq
MIRT1242907	hsa-miR-342-3p	CLIP-seq
MIRT1242911	hsa-miR-3935	CLIP-seq
MIRT2071797	hsa-miR-421	CLIP-seq
MIRT2071798	hsa-miR-4293	CLIP-seq
MIRT1242920	hsa-miR-4492	CLIP-seq
MIRT1242921	hsa-miR-4498	CLIP-seq
MIRT1242924	hsa-miR-4656	CLIP-seq
MIRT1242926	hsa-miR-4674	CLIP-seq
MIRT1242927	hsa-miR-4675	CLIP-seq
MIRT1242930	hsa-miR-4695-3p	CLIP-seq
MIRT1242931	hsa-miR-4741	CLIP-seq
MIRT2071799	hsa-miR-4777-5p	CLIP-seq
MIRT2071800	hsa-miR-4778-3p	CLIP-seq
MIRT2071801	hsa-miR-583	CLIP-seq
MIRT2071802	hsa-miR-596	CLIP-seq
MIRT1242940	hsa-miR-670	CLIP-seq
MIRT1242941	hsa-miR-762	CLIP-seq
MIRT1242943	hsa-miR-9	CLIP-seq
MIRT1242887	hsa-miR-128	CLIP-seq
MIRT1242890	hsa-miR-149	CLIP-seq
MIRT1242894	hsa-miR-203	CLIP-seq
MIRT2298942	hsa-miR-2276	CLIP-seq
MIRT1242896	hsa-miR-27a	CLIP-seq
MIRT1242897	hsa-miR-27b	CLIP-seq
MIRT1242898	hsa-miR-3064-5p	CLIP-seq
MIRT1242901	hsa-miR-3180-5p	CLIP-seq
MIRT1242902	hsa-miR-320a	CLIP-seq
MIRT1242903	hsa-miR-320b	CLIP-seq
MIRT1242904	hsa-miR-320c	CLIP-seq
MIRT1242905	hsa-miR-320d	CLIP-seq
MIRT1242910	hsa-miR-3909	CLIP-seq
MIRT2071797	hsa-miR-421	CLIP-seq
MIRT1242913	hsa-miR-4287	CLIP-seq
MIRT1242915	hsa-miR-4300	CLIP-seq
MIRT1242916	hsa-miR-4325	CLIP-seq
MIRT1242917	hsa-miR-4429	CLIP-seq
MIRT1242918	hsa-miR-4469	CLIP-seq
MIRT1242919	hsa-miR-4477a	CLIP-seq
MIRT1242928	hsa-miR-4685-3p	CLIP-seq
MIRT1242929	hsa-miR-4691-3p	CLIP-seq
MIRT2298943	hsa-miR-4691-5p	CLIP-seq
MIRT2298944	hsa-miR-4709-5p	CLIP-seq
MIRT2298945	hsa-miR-4713-5p	CLIP-seq
MIRT2298946	hsa-miR-4772-3p	CLIP-seq
MIRT2071800	hsa-miR-4778-3p	CLIP-seq
MIRT1242932	hsa-miR-4794	CLIP-seq
MIRT2298947	hsa-miR-501-3p	CLIP-seq
MIRT2298948	hsa-miR-502-3p	CLIP-seq
MIRT1242936	hsa-miR-513a-5p	CLIP-seq
MIRT2298949	hsa-miR-516a-3p	CLIP-seq
MIRT2298950	hsa-miR-544	CLIP-seq
MIRT1242938	hsa-miR-561	CLIP-seq
MIRT1242944	hsa-miR-920	CLIP-seq
MIRT1242945	hsa-miR-935	CLIP-seq
MIRT2392683	hsa-miR-1972	CLIP-seq
MIRT2392684	hsa-miR-214	CLIP-seq
MIRT2392685	hsa-miR-219-2-3p	CLIP-seq
MIRT2392686	hsa-miR-3619-5p	CLIP-seq
MIRT2392687	hsa-miR-4530	CLIP-seq
MIRT2392688	hsa-miR-4690-5p	CLIP-seq
MIRT2392689	hsa-miR-4717-5p	CLIP-seq
MIRT2392690	hsa-miR-761	CLIP-seq
MIRT1242912	hsa-miR-4275	CLIP-seq
MIRT1242912	hsa-miR-4275	CLIP-seq

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	15242618
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000785	Component	Chromatin	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19001868, 20352051, 20531387, 23983262
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	20352051, 20531387, 25416956, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23983262
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	15242618
GO:0005814	Component	Centriole	IBA
GO:0005814	Component	Centriole	IDA	19001868
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	20352051
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007052	Process	Mitotic spindle organization	IDA	19001868
GO:0007052	Process	Mitotic spindle organization	IEA
GO:0007052	Process	Mitotic spindle organization	ISS
GO:0007265	Process	Ras protein signal transduction	ISS
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0010508	Process	Positive regulation of autophagy	IDA	23983262
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010564	Process	Regulation of cell cycle process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	TAS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032486	Process	Rap protein signal transduction	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043008	Function	ATP-dependent protein binding	IDA	23983262
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	23983262
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0046599	Process	Regulation of centriole replication	IDA	19001868, 20352051, 20531387
GO:0046599	Process	Regulation of centriole replication	IMP	15242618
GO:0048167	Process	Regulation of synaptic plasticity	IBA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060292	Process	Long-term synaptic depression	ISS
GO:0071866	Process	Negative regulation of apoptotic process in bone marrow cell	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IEA

MIM	HGNC	e!Ensembl
607023	19699	ENSG00000145632

Protein

UniProt ID

Q9NYY3

Protein name

Serine/threonine-protein kinase PLK2 (EC 2.7.11.21) (Polo-like kinase 2) (PLK-2) (hPlk2) (Serine/threonine-protein kinase SNK) (hSNK) (Serum-inducible kinase)

Protein function

Tumor suppressor serine/threonine-protein kinase involved in synaptic plasticity, centriole duplication and G1/S phase transition. Polo-like kinases act by binding and phosphorylating proteins that are already phosphorylated on a specific motif

PDB

4I5M , 4I5P , 4I6B , 4I6F , 4I6H , 4RS6 , 4XB0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	82 → 334	Protein kinase domain	Domain
PF00659	POLO_box	511 → 572	POLO box duplicated region	Family
PF00659	POLO_box	607 → 676	POLO box duplicated region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at higher level in the fetal lung, kidney, spleen and heart. {ECO:0000269|PubMed:11696980}.

Sequence

MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN

Sequence length

685

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway		TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain CD163 mediating an anti-inflammatory response

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Astrocytoma	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes, Type 2 diabetes (age of onset)	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34080290
Astrocytoma	Associate	26378811
Breast Neoplasms	Associate	30327465
Burkitt Lymphoma	Associate	16160013
Carcinogenesis	Associate	25338102
Carcinoma Ovarian Epithelial	Associate	21402713
Carcinoma Squamous Cell	Associate	34080290
Colorectal Neoplasms	Associate	29448085, 35579380
Diabetic Nephropathies	Associate	37986381
Drug Related Side Effects and Adverse Reactions	Associate	19764992, 21402713
Glioblastoma	Associate	35256538, 37387444
Glioma	Associate	26378811
Laryngeal Neoplasms	Associate	25239093
Leukemia B Cell	Associate	16160013
Leukemia Lymphocytic Chronic B Cell	Associate	19764992
Lung Neoplasms	Associate	34080290
Lymphoma B Cell	Inhibit	16160013
Melanoma	Associate	28417283
Mitochondrial Diseases	Associate	36684674
Multiple Myeloma	Associate	32878237
Neoplasms	Associate	15967107, 20473878, 25239093, 26762835, 29448085, 40095483
Neoplasms	Inhibit	16160013, 25846005, 26910911
Neoplasms	Stimulate	37387444
Neuroblastoma	Associate	25338102
Osteosarcoma	Associate	26625870
Ovarian Neoplasms	Associate	21402713
Parkinson Disease	Associate	25338102
Polyps	Associate	29448085
Squamous Cell Carcinoma of Head and Neck	Associate	25239093
Synucleinopathies	Associate	25338102
Uterine Cervical Neoplasms	Associate	26910911

PLK2 (polo like kinase 2)