PLK4 (polo like kinase 4)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10733
Gene name Polo like kinase 4
Gene symbol PLK4
Synonyms (NCBI Gene)
MCCRP2SAKSTK18
Chromosome 4
Chromosome location 4q28.1
Summary This gene encodes a member of the polo family of serine/threonine protein kinases. The protein localizes to centrioles, complex microtubule-based structures found in centrosomes, and regulates centriole duplication during the cell cycle. Three alternative
SNPs SNP information provided by dbSNP.
3
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
SNP ID Visualize variation Clinical significance Consequence
rs724159995 C>G Pathogenic Intron variant
rs724159996 TAAAG>- Pathogenic Frameshift variant, coding sequence variant, intron variant
rs1379328798 C>G Likely-pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
25
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (25)
miRTarBase ID miRNA Experiments Reference
MIRT024738 hsa-miR-215-5p Microarray 19074876
MIRT026169 hsa-miR-192-5p Microarray 19074876
MIRT735559 hsa-miR-654-3p Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR 32884289
MIRT736915 hsa-miR-126-3p Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR 33416109
MIRT1242963 hsa-miR-129-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
E2F4 Unknown 24071582
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
46
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (46)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001741 Component XY body IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IDA 21725316, 27796307
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605031 11397 ENSG00000142731
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00444
Protein name Serine/threonine-protein kinase PLK4 (EC 2.7.11.21) (Polo-like kinase 4) (PLK-4) (Serine/threonine-protein kinase 18) (Serine/threonine-protein kinase Sak)
Protein function Serine/threonine-protein kinase that plays a central role in centriole duplication. Able to trigger procentriole formation on the surface of the parental centriole cylinder, leading to the recruitment of centriole biogenesis proteins such as SAS
PDB 2N19 , 3COK , 4JXF , 4N7V , 4N7Z , 4N9J , 4YUR , 4YYP , 5LHY , 5LHZ , 6N45 , 6N46 , 6W38 , 6W3I , 6W3J , 8XPG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 12 → 265 Protein kinase domain Domain
PF18190 Plk4_PB1 591 → 697 Polo-like Kinase 4 Polo Box 1 Domain
PF18409 Plk4_PB2 699 → 807 Polo-like Kinase 4 Polo Box 2 Domain
Sequence 
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQ
NTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILL
MFSNPTPNFH
Sequence length 970
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  FoxO signaling pathway   Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
62
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Microcephaly and chorioretinopathy 2 Likely pathogenic; Pathogenic rs1473460404, rs780106984, rs724159995, rs2546013773, rs2546018442 RCV001333037
RCV005630966
RCV000149795
RCV003988939
RCV004006245
PLK4-related microcephaly and growth failure with or without ocular features Likely pathogenic rs1456235557 RCV001270840
Show/Hide Unknown Diseases (22)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs60279389 RCV005922098
Cervical cancer Uncertain significance rs372101886 RCV005925483
Chronic lymphocytic leukemia/small lymphocytic lymphoma Uncertain significance rs1735113279 RCV005869977
Colon adenocarcinoma Likely benign rs753429702 RCV005867039
Show/Hide Text Mining Associations (55)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 21609466
Abortion Habitual Associate 28238495
Adenocarcinoma of Lung Associate 34080290
Aneuploidy Associate 31489978, 35536377
Autosomal Recessive Primary Microcephaly Associate 27650967, 35536377
Azoospermia Associate 26452337, 35366911
Azoospermia Nonobstructive Associate 26452337
Breast Neoplasms Associate 17465192, 30337519, 31142743, 34933912
Carcinogenesis Inhibit 29352113
Carcinogenesis Associate 35670224