OGA (O-GlcNAcase)

Gene

• Entrez ID: 10724
• Gene name: O-GlcNAcase
• Gene symbol: OGA
• Synonyms (NCBI Gene): MEA5, MGEA5, NCOAT
• Chromosome: 10
• Chromosome location: 10q24.32
• Summary: The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-Gl

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004415	Function	Hyalurononglucosaminidase activity	TAS	9811929
GO:0005634	Component	Nucleus	IDA	11341771
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11148210
GO:0006044	Process	N-acetylglucosamine metabolic process	IDA	11148210
GO:0006044	Process	N-acetylglucosamine metabolic process	IEA
GO:0006493	Process	Protein O-linked glycosylation	NAS	26363795
GO:0006516	Process	Glycoprotein catabolic process	TAS	9811929
GO:0006517	Process	Protein deglycosylation	IDA	11148210
GO:0009100	Process	Glycoprotein metabolic process	IBA
GO:0015929	Function	Hexosaminidase activity	IBA
GO:0015929	Function	Hexosaminidase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0042802	Function	Identical protein binding	IPI	28319083, 28346407
GO:0102571	Function	[protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine/L-threonine O-N-acetyl-alpha-D-glucosaminase activity	IBA
GO:0102571	Function	[protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine/L-threonine O-N-acetyl-alpha-D-glucosaminase activity	IDA	11148210
GO:0102571	Function	[protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine/L-threonine O-N-acetyl-alpha-D-glucosaminase activity	IEA
GO:0140096	Function	Catalytic activity, acting on a protein	IEA

Other IDs

• MIM: 604039
• HGNC: 7056
• e!Ensembl: ENSG00000198408

Protein

• UniProt ID: O60502
• Protein name: Protein O-GlcNAcase (OGA) (EC 3.2.1.169) (Beta-N-acetylglucosaminidase) (Beta-N-acetylhexosaminidase) (Beta-hexosaminidase) (Meningioma-expressed antigen 5) (N-acetyl-beta-D-glucosaminidase) (N-acetyl-beta-glucosaminidase) (Nuclear cytoplasmic O-GlcNAcase
• Protein function: [Isoform 1]: Cleaves GlcNAc but not GalNAc from O-glycosylated proteins (PubMed:11148210, PubMed:11788610, PubMed:20673219, PubMed:22365600, PubMed:24088714, PubMed:28939839, PubMed:37962578). Deglycosylates a large and diverse number of protein
• PDB: 2YDQ, 5M7R, 5M7S, 5M7T, 5M7U, 5TKE, 5UHK, 5UHL, 5UHO, 5UHP, 5UN8, 5UN9, 5VVO, 5VVT, 5VVU, 5VVV, 5VVX, 6HKI, 6PM9, 7OU6, 7YEH, 8P0L, 9BA8, 9BA9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07555	NAGidase	62 → 361	beta-N-acetylglucosaminidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Shows highest expression in the brain, placenta and pancreas. {ECO:0000269|PubMed:11148210, ECO:0000269|PubMed:11341771}.
• Sequence:

  MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
  LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
  TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
  CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
  LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
  TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
  NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA
  PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKND
  NQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
  GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
  SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
  LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
  FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
  LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
  SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
  KMEGFPKDVVILGRSL

• Sequence length: 916

Pathways

KEGG:

Insulin resistance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Abortion Spontaneous	Associate	39684334	★☆☆☆☆ Found in Text Mining only
Acute Kidney Injury	Associate	24180435	★☆☆☆☆ Found in Text Mining only
Acute Kidney Injury	Stimulate	29179690	★☆☆☆☆ Found in Text Mining only
Adenoameloblastoma	Associate	29979612	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	25860248	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Stimulate	29179690	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	24859566, 33285636, 34186233	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	11566258, 21567137	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	23480751	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22730328	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	20413512	★☆☆☆☆ Found in Text Mining only
DK Phocomelia Syndrome	Stimulate	36330072	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	29518421	★☆☆☆☆ Found in Text Mining only
Gangliosidoses GM2	Associate	2140574, 23158871, 2964638	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	22730328	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Associate	20413512	★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Associate	35298547	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	33066744, 35298547	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	28878262, 33801653	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	21567137	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Inhibit	40128844	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	29167312	★☆☆☆☆ Found in Text Mining only
Lysosomal Storage Diseases	Associate	12662933	★☆☆☆☆ Found in Text Mining only
Mast Cell Activation Disorders	Associate	28919488	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Associate	27070276	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Associate	23158871	★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Associate	6289658, 848490	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	25315705	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	11566258, 25315705	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21717526, 28571750, 29979612	★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	25315705	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Associate	30396309	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Inhibit	21567137	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	24333294	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	27402830	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Stimulate	24436092	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	31703585	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Associate	9066978	★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Associate	2170400	★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	21717526, 28692601, 29979612, 35546636	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tauopathies	Associate	30644846, 34186233	★☆☆☆☆ Found in Text Mining only
Tay Sachs Disease	Associate	10806593, 12662933, 1387685, 14724290, 1831451, 2140574, 23393155, 2449434, 2531748, 2952641, 35575117, 6236461, 6959123	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	32174982	★☆☆☆☆ Found in Text Mining only