Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1072
Gene name Gene Name - the full gene name approved by the HGNC.	Cofilin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CFL1
Synonyms (NCBI Gene) Gene synonyms aliases	CFL, HEL-S-15, cofilin
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distri

Show/Hide all(380)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025334	hsa-miR-34a-5p	Proteomics	21566225
MIRT025334	hsa-miR-34a-5p	Proteomics	21566225
MIRT043254	hsa-miR-324-5p	CLASH	23622248
MIRT041842	hsa-miR-484	CLASH	23622248
MIRT041581	hsa-miR-193b-3p	CLASH	23622248
MIRT037082	hsa-miR-877-3p	CLASH	23622248
MIRT036064	hsa-miR-1301-3p	CLASH	23622248
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887437	hsa-miR-1252	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887439	hsa-miR-1271	CLIP-seq
MIRT887440	hsa-miR-182	CLIP-seq
MIRT887441	hsa-miR-2115	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887443	hsa-miR-3122	CLIP-seq
MIRT887444	hsa-miR-3151	CLIP-seq
MIRT887445	hsa-miR-3155	CLIP-seq
MIRT887446	hsa-miR-3155b	CLIP-seq
MIRT887447	hsa-miR-3157-3p	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887451	hsa-miR-3665	CLIP-seq
MIRT887452	hsa-miR-370	CLIP-seq
MIRT887453	hsa-miR-3913-5p	CLIP-seq
MIRT887454	hsa-miR-3928	CLIP-seq
MIRT887455	hsa-miR-3934	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887457	hsa-miR-4283	CLIP-seq
MIRT887458	hsa-miR-4290	CLIP-seq
MIRT887459	hsa-miR-4419a	CLIP-seq
MIRT887460	hsa-miR-4434	CLIP-seq
MIRT887461	hsa-miR-4436b-3p	CLIP-seq
MIRT887462	hsa-miR-4438	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887466	hsa-miR-4489	CLIP-seq
MIRT887467	hsa-miR-4493	CLIP-seq
MIRT887468	hsa-miR-450b-3p	CLIP-seq
MIRT887469	hsa-miR-4510	CLIP-seq
MIRT887470	hsa-miR-4516	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887472	hsa-miR-4534	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887476	hsa-miR-4672	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT887479	hsa-miR-4713-3p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT887483	hsa-miR-4729	CLIP-seq
MIRT887484	hsa-miR-4731-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887486	hsa-miR-4749-3p	CLIP-seq
MIRT887487	hsa-miR-4753-5p	CLIP-seq
MIRT887488	hsa-miR-4789-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887490	hsa-miR-4802-5p	CLIP-seq
MIRT887491	hsa-miR-493	CLIP-seq
MIRT887492	hsa-miR-5095	CLIP-seq
MIRT887493	hsa-miR-511	CLIP-seq
MIRT887494	hsa-miR-516a-3p	CLIP-seq
MIRT887495	hsa-miR-543	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887500	hsa-miR-638	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887502	hsa-miR-769-3p	CLIP-seq
MIRT887503	hsa-miR-874	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT887505	hsa-miR-96	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887454	hsa-miR-3928	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT887491	hsa-miR-493	CLIP-seq
MIRT887493	hsa-miR-511	CLIP-seq
MIRT887437	hsa-miR-1252	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887459	hsa-miR-4419a	CLIP-seq
MIRT887460	hsa-miR-4434	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887469	hsa-miR-4510	CLIP-seq
MIRT887470	hsa-miR-4516	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887437	hsa-miR-1252	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887439	hsa-miR-1271	CLIP-seq
MIRT887440	hsa-miR-182	CLIP-seq
MIRT1963217	hsa-miR-1909	CLIP-seq
MIRT887441	hsa-miR-2115	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887443	hsa-miR-3122	CLIP-seq
MIRT887444	hsa-miR-3151	CLIP-seq
MIRT1963218	hsa-miR-3154	CLIP-seq
MIRT887445	hsa-miR-3155	CLIP-seq
MIRT887446	hsa-miR-3155b	CLIP-seq
MIRT887447	hsa-miR-3157-3p	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887451	hsa-miR-3665	CLIP-seq
MIRT887452	hsa-miR-370	CLIP-seq
MIRT887453	hsa-miR-3913-5p	CLIP-seq
MIRT887454	hsa-miR-3928	CLIP-seq
MIRT887455	hsa-miR-3934	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887457	hsa-miR-4283	CLIP-seq
MIRT887458	hsa-miR-4290	CLIP-seq
MIRT887459	hsa-miR-4419a	CLIP-seq
MIRT887460	hsa-miR-4434	CLIP-seq
MIRT887461	hsa-miR-4436b-3p	CLIP-seq
MIRT887462	hsa-miR-4438	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887466	hsa-miR-4489	CLIP-seq
MIRT887467	hsa-miR-4493	CLIP-seq
MIRT887468	hsa-miR-450b-3p	CLIP-seq
MIRT887469	hsa-miR-4510	CLIP-seq
MIRT1963219	hsa-miR-4514	CLIP-seq
MIRT887470	hsa-miR-4516	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887472	hsa-miR-4534	CLIP-seq
MIRT1963220	hsa-miR-4640-5p	CLIP-seq
MIRT1963221	hsa-miR-4645-5p	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887476	hsa-miR-4672	CLIP-seq
MIRT1963222	hsa-miR-4673	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT1963223	hsa-miR-4692	CLIP-seq
MIRT887479	hsa-miR-4713-3p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT1963224	hsa-miR-4726-5p	CLIP-seq
MIRT887483	hsa-miR-4729	CLIP-seq
MIRT887484	hsa-miR-4731-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887486	hsa-miR-4749-3p	CLIP-seq
MIRT887487	hsa-miR-4753-5p	CLIP-seq
MIRT887488	hsa-miR-4789-5p	CLIP-seq
MIRT1963225	hsa-miR-4795-3p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887490	hsa-miR-4802-5p	CLIP-seq
MIRT887491	hsa-miR-493	CLIP-seq
MIRT887492	hsa-miR-5095	CLIP-seq
MIRT887493	hsa-miR-511	CLIP-seq
MIRT887494	hsa-miR-516a-3p	CLIP-seq
MIRT887495	hsa-miR-543	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887500	hsa-miR-638	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887502	hsa-miR-769-3p	CLIP-seq
MIRT887503	hsa-miR-874	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT1963226	hsa-miR-940	CLIP-seq
MIRT887505	hsa-miR-96	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887437	hsa-miR-1252	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887439	hsa-miR-1271	CLIP-seq
MIRT887440	hsa-miR-182	CLIP-seq
MIRT1963217	hsa-miR-1909	CLIP-seq
MIRT887441	hsa-miR-2115	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887443	hsa-miR-3122	CLIP-seq
MIRT887444	hsa-miR-3151	CLIP-seq
MIRT1963218	hsa-miR-3154	CLIP-seq
MIRT887445	hsa-miR-3155	CLIP-seq
MIRT887446	hsa-miR-3155b	CLIP-seq
MIRT887447	hsa-miR-3157-3p	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887451	hsa-miR-3665	CLIP-seq
MIRT887452	hsa-miR-370	CLIP-seq
MIRT887453	hsa-miR-3913-5p	CLIP-seq
MIRT887454	hsa-miR-3928	CLIP-seq
MIRT887455	hsa-miR-3934	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887457	hsa-miR-4283	CLIP-seq
MIRT887458	hsa-miR-4290	CLIP-seq
MIRT887459	hsa-miR-4419a	CLIP-seq
MIRT887460	hsa-miR-4434	CLIP-seq
MIRT887461	hsa-miR-4436b-3p	CLIP-seq
MIRT887462	hsa-miR-4438	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887466	hsa-miR-4489	CLIP-seq
MIRT887467	hsa-miR-4493	CLIP-seq
MIRT887468	hsa-miR-450b-3p	CLIP-seq
MIRT887469	hsa-miR-4510	CLIP-seq
MIRT1963219	hsa-miR-4514	CLIP-seq
MIRT887470	hsa-miR-4516	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887472	hsa-miR-4534	CLIP-seq
MIRT1963220	hsa-miR-4640-5p	CLIP-seq
MIRT1963221	hsa-miR-4645-5p	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887476	hsa-miR-4672	CLIP-seq
MIRT1963222	hsa-miR-4673	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT1963223	hsa-miR-4692	CLIP-seq
MIRT887479	hsa-miR-4713-3p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT1963224	hsa-miR-4726-5p	CLIP-seq
MIRT887483	hsa-miR-4729	CLIP-seq
MIRT887484	hsa-miR-4731-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887486	hsa-miR-4749-3p	CLIP-seq
MIRT887487	hsa-miR-4753-5p	CLIP-seq
MIRT887488	hsa-miR-4789-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887490	hsa-miR-4802-5p	CLIP-seq
MIRT887491	hsa-miR-493	CLIP-seq
MIRT887492	hsa-miR-5095	CLIP-seq
MIRT887494	hsa-miR-516a-3p	CLIP-seq
MIRT887495	hsa-miR-543	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887500	hsa-miR-638	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887502	hsa-miR-769-3p	CLIP-seq
MIRT887503	hsa-miR-874	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT1963226	hsa-miR-940	CLIP-seq
MIRT887505	hsa-miR-96	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887441	hsa-miR-2115	CLIP-seq
MIRT887443	hsa-miR-3122	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887452	hsa-miR-370	CLIP-seq
MIRT887453	hsa-miR-3913-5p	CLIP-seq
MIRT887454	hsa-miR-3928	CLIP-seq
MIRT887459	hsa-miR-4419a	CLIP-seq
MIRT887460	hsa-miR-4434	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887467	hsa-miR-4493	CLIP-seq
MIRT887469	hsa-miR-4510	CLIP-seq
MIRT887470	hsa-miR-4516	CLIP-seq
MIRT887472	hsa-miR-4534	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887476	hsa-miR-4672	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887487	hsa-miR-4753-5p	CLIP-seq
MIRT887488	hsa-miR-4789-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887490	hsa-miR-4802-5p	CLIP-seq
MIRT887491	hsa-miR-493	CLIP-seq
MIRT887494	hsa-miR-516a-3p	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT887452	hsa-miR-370	CLIP-seq
MIRT887439	hsa-miR-1271	CLIP-seq
MIRT887440	hsa-miR-182	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887505	hsa-miR-96	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887439	hsa-miR-1271	CLIP-seq
MIRT887440	hsa-miR-182	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887443	hsa-miR-3122	CLIP-seq
MIRT887445	hsa-miR-3155	CLIP-seq
MIRT887446	hsa-miR-3155b	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887453	hsa-miR-3913-5p	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887462	hsa-miR-4438	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887492	hsa-miR-5095	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq
MIRT887505	hsa-miR-96	CLIP-seq
MIRT887435	hsa-miR-103a	CLIP-seq
MIRT887436	hsa-miR-107	CLIP-seq
MIRT887438	hsa-miR-1254	CLIP-seq
MIRT887442	hsa-miR-3116	CLIP-seq
MIRT887445	hsa-miR-3155	CLIP-seq
MIRT887446	hsa-miR-3155b	CLIP-seq
MIRT887448	hsa-miR-3157-5p	CLIP-seq
MIRT887449	hsa-miR-342-5p	CLIP-seq
MIRT887450	hsa-miR-361-3p	CLIP-seq
MIRT887456	hsa-miR-3977	CLIP-seq
MIRT887462	hsa-miR-4438	CLIP-seq
MIRT887463	hsa-miR-4447	CLIP-seq
MIRT887464	hsa-miR-4471	CLIP-seq
MIRT887465	hsa-miR-4472	CLIP-seq
MIRT887471	hsa-miR-4527	CLIP-seq
MIRT887473	hsa-miR-4651	CLIP-seq
MIRT887474	hsa-miR-4664-5p	CLIP-seq
MIRT887475	hsa-miR-4668-3p	CLIP-seq
MIRT887477	hsa-miR-4685-5p	CLIP-seq
MIRT887478	hsa-miR-4690-3p	CLIP-seq
MIRT887480	hsa-miR-4715-5p	CLIP-seq
MIRT887481	hsa-miR-4716-3p	CLIP-seq
MIRT887482	hsa-miR-4723-5p	CLIP-seq
MIRT887485	hsa-miR-4747-5p	CLIP-seq
MIRT887489	hsa-miR-4797-5p	CLIP-seq
MIRT887492	hsa-miR-5095	CLIP-seq
MIRT887496	hsa-miR-550a	CLIP-seq
MIRT887497	hsa-miR-608	CLIP-seq
MIRT887498	hsa-miR-625	CLIP-seq
MIRT887499	hsa-miR-637	CLIP-seq
MIRT887501	hsa-miR-661	CLIP-seq
MIRT887504	hsa-miR-885-3p	CLIP-seq

Show/Hide all(107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001842	Process	Neural fold formation	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12361576, 15161933, 15846844, 16189514, 16713569, 17853892, 19424295, 20029029, 20133759, 21516116, 21525957, 24658140, 25416956, 25556234, 29892012, 30021884, 31515488, 31980649, 32296183, 32814053, 33961781, 35271311
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8195165, 16130169
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25556234
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA	29162887
GO:0006606	Process	Protein import into nucleus	IEA
GO:0007010	Process	Cytoskeleton organization	IMP	21834987
GO:0007015	Process	Actin filament organization	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007266	Process	Rho protein signal transduction	TAS	10436159
GO:0008154	Process	Actin polymerization or depolymerization	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010592	Process	Positive regulation of lamellipodium assembly	IEA
GO:0010593	Process	Negative regulation of lamellipodium assembly	IEA
GO:0014823	Process	Response to activity	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IMP	21834987
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030030	Process	Cell projection organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030042	Process	Actin filament depolymerization	IDA	11812157
GO:0030042	Process	Actin filament depolymerization	IEA
GO:0030042	Process	Actin filament depolymerization	NAS	24052308
GO:0030043	Process	Actin filament fragmentation	IBA
GO:0030043	Process	Actin filament fragmentation	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030835	Process	Negative regulation of actin filament depolymerization	IEA
GO:0030836	Process	Positive regulation of actin filament depolymerization	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032232	Process	Negative regulation of actin filament bundle assembly	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0040019	Process	Positive regulation of embryonic development	IEA
GO:0040019	Process	Positive regulation of embryonic development	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043197	Component	Dendritic spine	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0044794	Process	Host-mediated activation of viral process	IMP	25556234
GO:0045792	Process	Negative regulation of cell size	IEA
GO:0045862	Process	Positive regulation of proteolysis	IEA
GO:0048870	Process	Cell motility	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051014	Process	Actin filament severing	IBA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	11812157
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	ISS
GO:0051293	Process	Establishment of spindle localization	IEA
GO:0051293	Process	Establishment of spindle localization	ISS
GO:0051511	Process	Negative regulation of unidimensional cell growth	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	IMP	24464040
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071362	Process	Cellular response to ether	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0090732	Component	Cofilin-actin rod	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098885	Process	Modification of postsynaptic actin cytoskeleton	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	IEA
GO:1902951	Process	Negative regulation of dendritic spine maintenance	IEA
GO:1905873	Process	Positive regulation of protein localization to cell leading edge	IEA
GO:1905875	Process	Negative regulation of postsynaptic density organization	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:2000146	Process	Negative regulation of cell motility	IEA
GO:2000147	Process	Positive regulation of cell motility	IEA
GO:2000784	Process	Positive regulation of establishment of cell polarity regulating cell shape	IEA
GO:2000814	Process	Positive regulation of barbed-end actin filament capping	IEA

MIM	HGNC	e!Ensembl
601442	1874	ENSG00000172757

Protein

UniProt ID

P23528

Protein name

Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform)

Protein function

Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity (PubMed:11812157). In conjunction with the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions

PDB

1Q8G , 1Q8X , 3J0S , 4BEX , 5HVK , 5L6W , 6UBY , 6UC0 , 6UC4 , 6VAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	13 → 152	Cofilin/tropomyosin-type actin-binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely distributed in various tissues.

Sequence

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Sequence length

166

Interactions

View interactions

	KEGG		Reactome
	Axon guidance Fc gamma R-mediated phagocytosis Regulation of actin cytoskeleton Pertussis Human immunodeficiency virus 1 infection		Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Show/Hide Unknown Diseases (8)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Allergic Sensitization	Allergic sensitization	N/A	N/A	GWAS
Breast cancer	Breast cancer	N/A	N/A	GWAS
Carcinoma	Basal cell carcinoma	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (111)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	39227817
Adenocarcinoma	Stimulate	20558337
Adenocarcinoma	Associate	22087286
Adenocarcinoma of Lung	Associate	24018823
Alzheimer Disease	Associate	35092861
Anemia Aplastic	Associate	35579089
Aortic Dissection	Associate	21288906
Arthritis Rheumatoid	Associate	20536734, 33430905
Astrocytoma	Associate	22742733
Autoimmune Diseases	Associate	35579089
Behcet Syndrome	Associate	20536734
Brain Neoplasms	Associate	29347944
Breast Neoplasms	Associate	20819441, 24505128, 25909173, 27462783, 27626171, 31078043, 34079084, 36737242, 40419795
Calcinosis Cutis	Associate	27496138
Carcinogenesis	Associate	23227181, 26344167
Carcinoma Hepatocellular	Associate	11768609, 28869833, 31988091, 36881382
Carcinoma Non Small Cell Lung	Associate	20564088, 24018823, 34148878
Carcinoma Ovarian Epithelial	Associate	34284854
Carcinoma Pancreatic Ductal	Stimulate	28161904
Carcinoma Pancreatic Ductal	Associate	29347944
Carcinoma Renal Cell	Associate	27128972
Carcinoma Squamous Cell	Associate	29846436
Cardiomyopathy Dilated	Associate	32863228
Cerebral Hemorrhage	Associate	35302736
Cognitive Dysfunction	Stimulate	39227817
Colonic Neoplasms	Associate	20558337, 22790341
Colorectal Neoplasms	Inhibit	11768609
Colorectal Neoplasms	Associate	25549357, 28358024, 30296500, 37193711
Deafness	Associate	19419963
Death	Associate	21364663, 29846436
Dermatitis Atopic	Stimulate	36305098
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	22087286
Dwarfism Pituitary	Associate	35262532
Dystonia	Associate	12325076
Epilepsy	Associate	35092861
Esophageal Neoplasms	Associate	26344167
Esophageal Squamous Cell Carcinoma	Associate	26190820, 26344167
Fibrocartilaginous embolism	Associate	24441571
Glioblastoma	Associate	23338717, 25237832, 28679472, 33649781
Glioma	Associate	28440461
Glomerulonephritis IGA	Associate	39227817
Glycosuria Renal	Associate	39227817
Hepatitis B	Associate	22552268
Heredodegenerative Disorders Nervous System	Associate	24425731
Hirschsprung Disease	Associate	35322726
HIV Infections	Associate	18928553, 30662943
Huntington Disease	Associate	35092861
Hyperplasia	Associate	29347944
Immune System Diseases	Associate	20536734
Infections	Stimulate	18928553
Infections	Associate	24418541, 35418661
Inflammation	Associate	24039253, 25653478, 35302736
Intestinal Diseases	Associate	29396473
Intracranial Hemorrhages	Associate	35302736
Irritable Bowel Syndrome	Associate	29396473
Keratoconus	Associate	19956410
Kidney Diseases	Stimulate	39227817
Leukemia	Associate	32124958
Leukemia Lymphocytic Chronic B Cell	Associate	18223168
Leukemia Prolymphocytic T Cell	Associate	27097566
Lissencephaly	Associate	35092861
Lung Neoplasms	Associate	29846436, 34321041
Lupus Erythematosus Systemic	Associate	20536734
Lymphangioleiomyomatosis	Associate	34445268
Lymphatic Metastasis	Associate	26344167, 29347944, 29846436
Lymphoma	Associate	8183936
Lymphoma B Cell Marginal Zone	Stimulate	28404907
Malformations of Cortical Development Group II	Associate	35092861
MASS syndrome	Associate	35262532
Medulloblastoma	Associate	30901604
Melanoma	Associate	18987670, 21857157
Mitochondrial Diseases	Associate	33174611
Mouth Neoplasms	Associate	23227181
Multiple Sclerosis	Associate	23692923
Myotonic Dystrophy	Associate	20536734
Nasopharyngeal Carcinoma	Associate	28827787
Nasopharyngeal Neoplasms	Associate	28827787
Necrosis	Associate	21364663
Neoplasm Invasiveness	Associate	20564088
Neoplasm Metastasis	Associate	18987670, 27496138, 28869833, 30092744, 35688384
Neoplasm Metastasis	Inhibit	22087286
Neoplasms	Associate	18401453, 20558337, 20564088, 21364663, 22742733, 24505128, 27496138, 28827787, 28869833, 29751634, 29846436, 34148878, 34381117, 34568889, 35688384 View all (4 more)
Neoplasms Glandular and Epithelial	Associate	29396473
Neural Tube Defects	Associate	17352815, 35092861
Neuroblastoma	Associate	18797883, 24293394, 31406249
Neurodegenerative Diseases	Associate	35092861
Neuroinflammatory Diseases	Associate	35302736
Non Muscle Invasive Bladder Neoplasms	Associate	23374291
Osteoarthritis	Associate	25653478
Osteogenesis Imperfecta	Associate	28802583
Ovarian Diseases	Associate	15591324
Ovarian Neoplasms	Associate	11071270
Pancreatic Diseases	Associate	29347944
Pancreatic Neoplasms	Associate	28161904
Pelvic Organ Prolapse	Inhibit	26612295
Placenta Accreta	Stimulate	30092744
Prostatic Neoplasms	Associate	12821664, 25344584
Salivary Gland Neoplasms	Associate	31098787
Schizophrenia	Associate	35092861
Seckel syndrome 1	Associate	23401567
Sjogren's Syndrome	Stimulate	28404907
Spinal Dysraphism	Associate	17352815
Stomach Diseases	Associate	30773850
Stomach Neoplasms	Associate	11768609, 33299895, 36316865
Tobacco Use Disorder	Stimulate	29846436
Triple Negative Breast Neoplasms	Associate	36584207
Urethral Neoplasms	Associate	27402302
Urinary Bladder Neoplasms	Associate	23374291, 27402302
Uterine Cervical Dysplasia	Associate	29347944
Ventricular Remodeling	Associate	39302489
Viremia	Associate	30662943

CFL1 (cofilin 1)